BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30076 (677 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 24 1.5 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 23 3.5 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 6.2 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.8 bits (49), Expect = 1.5 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -3 Query: 624 LSDNSCWINLI*FLKFVTSRHLSHKFR*NNSIEDNM 517 LS C + ++ F TS +S KFR IEDN+ Sbjct: 590 LSSMLCIPGYMIYIWFTTSGTISEKFRKLIRIEDNV 625 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.6 bits (46), Expect = 3.5 Identities = 13/62 (20%), Positives = 28/62 (45%) Frame = +1 Query: 388 LHISFVNSFGMFKKNILTLTSVSLLHFFIIHNLFIGAPISFEIHIIFNGIVLSKFMAKMP 567 +HI +G + + + ++++ +++ L PIS +H +VL + P Sbjct: 125 IHIKDPLRYGRWVTRRIAVAGIAVV--WLLAGLISFVPISLGLHRANEPVVLDDSKEEHP 182 Query: 568 TC 573 TC Sbjct: 183 TC 184 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 6.2 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 624 LSDNSCWINLI*FLKFVTSRHLSHKFR*NNSIEDNM 517 LS C + ++ F TS +S KFR IED++ Sbjct: 537 LSSMLCIPGYMIYIWFTTSGTISEKFRKLIRIEDDV 572 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,806 Number of Sequences: 438 Number of extensions: 3805 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -