BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30075 (607 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 35 0.044 SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) 34 0.078 SB_19262| Best HMM Match : Laminin_EGF (HMM E-Value=0.36) 33 0.24 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 32 0.41 SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) 32 0.41 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 31 0.55 SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.55 SB_15061| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_42623| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 31 0.96 SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) 30 1.7 SB_11402| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_28657| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_52208| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_15403| Best HMM Match : CH (HMM E-Value=0) 29 2.2 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_18829| Best HMM Match : Filament_head (HMM E-Value=5.6) 29 3.9 SB_41025| Best HMM Match : APC_crr (HMM E-Value=6.7) 29 3.9 SB_16741| Best HMM Match : FYVE (HMM E-Value=7.1) 29 3.9 SB_16683| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_35205| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_2299| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_49457| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_35742| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_12242| Best HMM Match : RGS (HMM E-Value=0.75) 28 6.7 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_52825| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_26019| Best HMM Match : F5_F8_type_C (HMM E-Value=2.6e-29) 28 6.7 SB_16033| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 27 8.9 SB_37261| Best HMM Match : rve (HMM E-Value=2.1e-08) 27 8.9 SB_19312| Best HMM Match : DEP (HMM E-Value=2.5e-09) 27 8.9 SB_3798| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 35.1 bits (77), Expect = 0.044 Identities = 20/60 (33%), Positives = 29/60 (48%) Frame = +2 Query: 293 RVREGVPPPLCAGRCVAPPAGPVCAFDAAGTRRTFATLCELEAVSCRESTYYAVTSLGVC 472 + R+G P +C G C A PVC D + ++ C L+ SCR++ V S G C Sbjct: 5285 KARDGRPECVCDGICSLVYA-PVCGTDG----QEYSNECNLQIASCRKNELIEVASRGSC 5339 Score = 27.5 bits (58), Expect = 8.9 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +2 Query: 356 PVCAFDAAGTRRTFATLCELEAVSCRESTYYAVTSLGVC 472 PVC D +T+ CEL +C+ + V SL C Sbjct: 5630 PVCGSDG----KTYNNECELRQYACKSDSLITVASLSSC 5664 >SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 325 Score = 34.3 bits (75), Expect = 0.078 Identities = 21/59 (35%), Positives = 27/59 (45%) Frame = +2 Query: 296 VREGVPPPLCAGRCVAPPAGPVCAFDAAGTRRTFATLCELEAVSCRESTYYAVTSLGVC 472 VR G P +C C A PVC D +T+ C LE SC+ +T +V G C Sbjct: 33 VRYGQPVCVCNEACTREYA-PVCGSDG----KTYPNPCALEVESCKTNTRISVIKKGSC 86 >SB_19262| Best HMM Match : Laminin_EGF (HMM E-Value=0.36) Length = 1173 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = -1 Query: 481 NYSANSQTCDGVIRAFATRNSLEFT*SSECPSRSGCIKGAHWSCRRGHAPP 329 N + S + D + AF NS + +CP R C+ G H +C G++ P Sbjct: 293 NLNDRSASSDAMTSAF---NSAVLPVAYQCPIRESCLGGLHGACSMGYSGP 340 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 31.9 bits (69), Expect = 0.41 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = +2 Query: 287 RARVREGVPPPLCAGRCVAPPA-GPVCAFDAAGTRRTFATLCELEAVSCRESTYYAVTSL 463 R +V +G P +C P + PVC+ T TF T C +E +C ES V Sbjct: 132 RCQVIKGKPQCVCRDVRECPSSMDPVCST----TGETFITKCHMEVEACTESRSMMVARR 187 Query: 464 GVC 472 G C Sbjct: 188 GEC 190 Score = 31.9 bits (69), Expect = 0.41 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +2 Query: 323 CAGRCVAPPAGPVCAFDAAGTRRTFATLCELEAVSCRESTYYAVTSLGVC 472 C PA VC +D +T+ + C +EA CR + + LG C Sbjct: 687 CPSESDCLPAAKVCGYDGK-VMKTYQSQCHMEAEGCRMAKDLQLIRLGSC 735 Score = 29.5 bits (63), Expect = 2.2 Identities = 20/60 (33%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = +2 Query: 296 VREGVPPPLCAGRCVAPPA-GPVCAFDAAGTRRTFATLCELEAVSCRESTYYAVTSLGVC 472 V +G P +C P + PVC+ T TF T C +E +C ES V G C Sbjct: 64 VIKGKPQCVCRDVRECPSSMDPVCST----TGETFITKCHMEVEACTESRSMMVARRGEC 119 >SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1488 Score = 31.9 bits (69), Expect = 0.41 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +2 Query: 323 CAGRCVAPPAGPVCAFDAAGTRRTFATLCELEAVSCRESTYYAVTSLGVC 472 C C + A PVC D RT+++ C ++A +C+ T AV G+C Sbjct: 803 CNTECPSE-ASPVCGQDG----RTYSSTCAMDARACQAQTSIAVKHPGLC 847 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 31.5 bits (68), Expect = 0.55 Identities = 22/61 (36%), Positives = 28/61 (45%) Frame = +2 Query: 179 DCMDKSRLRQSTVHSNEIGERQRSQPPDMRAPGELVRARVREGVPPPLCAGRCVAPPAGP 358 D MD R R TV S + E + PP +P + A + PPPL AG PP P Sbjct: 488 DSMDDQRDRAETVESLDFVEDRSPPPPPPASPPPPLPAE-EDNSPPPLPAG---PPPDEP 543 Query: 359 V 361 + Sbjct: 544 M 544 >SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4475 Score = 31.5 bits (68), Expect = 0.55 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 Query: 293 RVREGVPPPLCAGRCVAPPAGPVCAFDAAGTRRTFATLCELEAVSC 430 +V++ P C RC+ P PVC D +T+ LCE+ SC Sbjct: 4227 KVKDEKPVCECPSRCL-PDKEPVCGADG----KTYRNLCEIRKASC 4267 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +2 Query: 305 GVPPPLCAGRCVAPPAGPVCAFDAAGTRRTFATLCELEAVSCRESTYYAVTSLGVC 472 G P +C C + + PVC D +T+ CEL+ +C V S G C Sbjct: 3964 GQPTCVCNKNCPST-SKPVCGSDG----KTYKNECELKRAACESKKNVTVASQGEC 4014 >SB_15061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 31.1 bits (67), Expect = 0.72 Identities = 20/62 (32%), Positives = 26/62 (41%) Frame = -2 Query: 438 LSRHETASSSHRVANVLRVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSSPGALIS 259 LS+H S+ VA LRV A P GA+H P R++ +S L Sbjct: 25 LSKHRRTSALASVAVTLRVTTTPAALNAPLQGASHSPFRLRNCWEGRSVRASSLLRQLAK 84 Query: 258 GG 253 GG Sbjct: 85 GG 86 >SB_42623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 30.7 bits (66), Expect = 0.96 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = -1 Query: 394 CPSRS--GCIKGAHWSCRRGHAPPCTQRRWHPLAD 296 C RS C +G+H SC +G P C Q +HP D Sbjct: 87 CDQRSHPSCDQGSHPSCDQGSHPSCDQ-EYHPSCD 120 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 30.7 bits (66), Expect = 0.96 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 3/70 (4%) Frame = +2 Query: 122 YLDSVGNVKRKGFCLYSF--SDCMDK-SRLRQSTVHSNEIGERQRSQPPDMRAPGELVRA 292 Y+ + +R+GFC SF D +DK + + N++ E +R+ P +++ +RA Sbjct: 135 YITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKV-EVKRALPKEVQQQQAALRA 193 Query: 293 RVREGVPPPL 322 G+ P L Sbjct: 194 AAGRGIIPAL 203 >SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1568 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/60 (28%), Positives = 26/60 (43%) Frame = +2 Query: 293 RVREGVPPPLCAGRCVAPPAGPVCAFDAAGTRRTFATLCELEAVSCRESTYYAVTSLGVC 472 R ++G P +C C + PVC D T+ LC L +C ++T + G C Sbjct: 588 RAQDGKPVCVCPPGCPSE-VKPVCGTDGV----TYDNLCSLRLKACTDNTRTRFKAFGEC 642 >SB_11402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 753 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -3 Query: 407 IE*RMSFAFRLHQRRTLVLPAGPRTALHTAAVAP 306 +E + S L Q+ T + PA PR+AL TA V+P Sbjct: 95 LELQQSSMALLQQQSTPIAPARPRSALQTAPVSP 128 >SB_28657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3296 Score = 29.5 bits (63), Expect = 2.2 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = -2 Query: 438 LSRHETASSSHRVANVLRVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSSPGALIS 259 L++H S+ VA LRV A P GA+H P R++ +S L Sbjct: 2356 LAQHRRTSALASVAVTLRVTTTPAALNAPLQGASHSPFRLRNCWEGRSVRASSLLRQLAK 2415 Query: 258 GG 253 GG Sbjct: 2416 GG 2417 >SB_52208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 640 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -1 Query: 475 SANSQTCDGVI-RAFATRNSLEFT*SSECPSRSGCIKGAHWSCRR 344 S+ + C G++ R FA+ ++E S++C S G +CRR Sbjct: 350 SSQKRACSGILSRPFASSETIEMENSNDCKQGSLSRAGGEVNCRR 394 >SB_15403| Best HMM Match : CH (HMM E-Value=0) Length = 1907 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/57 (29%), Positives = 23/57 (40%) Frame = +2 Query: 302 EGVPPPLCAGRCVAPPAGPVCAFDAAGTRRTFATLCELEAVSCRESTYYAVTSLGVC 472 +G +C+ C A PVC D T+ LC L A C+ T+ G C Sbjct: 717 DGKTKCVCSAACTREYA-PVCGSDG----NTYNNLCLLTAARCQSQTFIYRAHFGTC 768 Score = 27.5 bits (58), Expect = 8.9 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +2 Query: 335 CVAPPAGPVCAFDAAGTRR-TFATLCELEAVSCRESTYYAVTSLGVC 472 C P A P+ GT T+ LC L A SCR V G C Sbjct: 1307 CPDPAACPLVKSRVCGTDGITYDNLCRLRAESCRRYQPVNVLHSGYC 1353 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/46 (26%), Positives = 18/46 (39%) Frame = +2 Query: 335 CVAPPAGPVCAFDAAGTRRTFATLCELEAVSCRESTYYAVTSLGVC 472 C+ P + A T+ + C LE SC+ Y + G C Sbjct: 1861 CICPTCPKAKDYLCASNNLTYMSKCHLERASCQLGRYLTIKQKGKC 1906 >SB_18829| Best HMM Match : Filament_head (HMM E-Value=5.6) Length = 153 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +2 Query: 170 SFSDCMDKSRLRQSTVHSNEIGERQRSQPPDMRAPGELVRARVREGV 310 SFS +R RQ+ H +G +S+ D+ PGE R G+ Sbjct: 45 SFSSLTSLARKRQNRTHDFSLGVAAKSEKVDLIFPGENKSIRGDHGI 91 >SB_41025| Best HMM Match : APC_crr (HMM E-Value=6.7) Length = 274 Score = 28.7 bits (61), Expect = 3.9 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 2/63 (3%) Frame = -2 Query: 435 SRHETASSSHRVANVLRVP--AASKAHTGPAGGATHRPAHSGGGTPSRTLARTSSPGALI 262 S + T+ H A R P + K+HT P S G+P R+ + TSS +L Sbjct: 93 SPNVTSHKDHSSALSERSPNITSQKSHTSADSTPARSPPGSINGSPGRSGSMTSSVSSLS 152 Query: 261 SGG 253 S G Sbjct: 153 SSG 155 >SB_16741| Best HMM Match : FYVE (HMM E-Value=7.1) Length = 556 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 308 PPRGPSLGPAHPGLSYPVADFFDAPQSRWN 219 P + P+L PA+P + + FF AP+ WN Sbjct: 48 PLQIPTLPPANPSQYFSTSFFFWAPKRTWN 77 >SB_16683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 378 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 308 PPRGPSLGPAHPGLSYPVADFFDAPQSRWN 219 P + P+L PA+P + + FF AP+ WN Sbjct: 265 PLQIPTLPPANPSQYFSTSFFFWAPKRTWN 294 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +2 Query: 356 PVCAFDAAGTRRTFATLCELEAVSCRESTYYAVTSLGVC 472 PVC D +T+ CE+ A +C +ST V G C Sbjct: 1305 PVCGTDG----KTYGNKCEMRASACLKSTMVTVAYPGEC 1339 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 356 PVCAFDAAGTRRTFATLCELEAVSCRESTYYAVTSLGVC 472 PVCA + +T++ C+++A +C T V S G C Sbjct: 1606 PVCASNG----KTYSNRCDMDADACIRDTKLTVVSQGAC 1640 Score = 27.5 bits (58), Expect = 8.9 Identities = 18/56 (32%), Positives = 23/56 (41%) Frame = +2 Query: 305 GVPPPLCAGRCVAPPAGPVCAFDAAGTRRTFATLCELEAVSCRESTYYAVTSLGVC 472 GVP C + VC D R T++ C L +C+ES V S G C Sbjct: 1434 GVPRCECPMFKCSANRSDVCGSD----RMTYSNECTLTQTACQESKNLTVVSQGPC 1485 >SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2323 Score = 28.7 bits (61), Expect = 3.9 Identities = 18/49 (36%), Positives = 21/49 (42%) Frame = -2 Query: 399 ANVLRVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSSPGALISGG 253 AN + P HTGP T + + G T T TS PG SGG Sbjct: 490 ANTIPTPVT---HTGPTARTTF--STNSGSTMGSTSVGTSGPGGSTSGG 533 >SB_35205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 301 ADPRSDQLTRGSHIRWLTSLTLPNLVGMN 215 A P+ + TRG R S+T+PN G+N Sbjct: 104 ASPQPAKFTRGRRFRSSGSITIPNAPGLN 132 >SB_2299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Frame = -1 Query: 277 TRGSHIRWLTSLTLPNLVGMNGRL-----AQSAFIHTVTKTIQTKTF 152 TRG H WL ++ +L G L A S +TVT+ +Q T+ Sbjct: 225 TRGGHYDWLLAVECRDLAGFEEALYKANAASSMLCNTVTELVQLSTW 271 >SB_49457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 941 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = -1 Query: 394 CPSRSGCIKGAHWSCRRGHAPP-CTQ 320 CP S C+ G CR G+ P C+Q Sbjct: 233 CPIESSCLGGLESRCREGYTGPLCSQ 258 >SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 27.9 bits (59), Expect = 6.7 Identities = 19/63 (30%), Positives = 25/63 (39%) Frame = -2 Query: 441 VLSRHETASSSHRVANVLRVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSSPGALI 262 V +H S+ VA LRV A P GA+H P R++ +S L Sbjct: 468 VYLQHRRTSALASVAVTLRVTTTPAALNAPLQGASHSPFRLRNCWEGRSVRASSLLRQLA 527 Query: 261 SGG 253 GG Sbjct: 528 KGG 530 >SB_35742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1113 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = -3 Query: 377 LHQRRTLVLPAGPRTALHTAAVAPPRGPSLGPAHPGLSYPVADFFDAPQSR 225 ++QR T L P T V PP GP L A A AP SR Sbjct: 913 VNQRATDPLATDPHATEGTDGVTPPAGPPLAAAQQTKDRVPATALRAPGSR 963 >SB_12242| Best HMM Match : RGS (HMM E-Value=0.75) Length = 737 Score = 27.9 bits (59), Expect = 6.7 Identities = 19/63 (30%), Positives = 25/63 (39%) Frame = -2 Query: 441 VLSRHETASSSHRVANVLRVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSSPGALI 262 V +H S+ VA LRV A P GA+H P R++ +S L Sbjct: 109 VTIQHRRTSALASVAVTLRVTTTPAALNAPLQGASHSPFRLRNCWEGRSVRASSLLRQLA 168 Query: 261 SGG 253 GG Sbjct: 169 KGG 171 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 27.9 bits (59), Expect = 6.7 Identities = 19/62 (30%), Positives = 24/62 (38%) Frame = -2 Query: 438 LSRHETASSSHRVANVLRVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSSPGALIS 259 L H S+ VA LRV A P GA+H P R++ +S L Sbjct: 585 LYEHRRTSALASVAVTLRVTTTPAALNAPLQGASHSPFRLRNCWEGRSVRASSLLRQLAK 644 Query: 258 GG 253 GG Sbjct: 645 GG 646 >SB_52825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1141 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/60 (30%), Positives = 24/60 (40%) Frame = -2 Query: 432 RHETASSSHRVANVLRVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSSPGALISGG 253 +H S+ VA LRV A P GA+H P R++ +S L GG Sbjct: 421 KHRRTSALASVAVTLRVTTTPAALNAPLQGASHSPFRLRNCWEGRSVRASSLLRQLAKGG 480 >SB_26019| Best HMM Match : F5_F8_type_C (HMM E-Value=2.6e-29) Length = 438 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/60 (30%), Positives = 24/60 (40%) Frame = -2 Query: 432 RHETASSSHRVANVLRVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSSPGALISGG 253 +H S+ VA LRV A P GA+H P R++ +S L GG Sbjct: 154 KHRRTSALASVAVTLRVTTTPAALNAPLQGASHSPFRLRNCWEGRSVRASSLLRQLAKGG 213 >SB_16033| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 354 PAGGATHRPAHSGGGTPSRTLARTSSP 274 PAG R AH+ P+R AR +SP Sbjct: 304 PAGNEASRTAHASRPAPTRETARETSP 330 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 27.5 bits (58), Expect = 8.9 Identities = 18/63 (28%), Positives = 24/63 (38%) Frame = -2 Query: 441 VLSRHETASSSHRVANVLRVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSSPGALI 262 + H S+ VA LRV A P GA+H P R++ +S L Sbjct: 369 LFKEHRRTSALASVAVTLRVTTTPAALNAPLQGASHSPFRLRNCWEGRSVRASSLLRQLA 428 Query: 261 SGG 253 GG Sbjct: 429 KGG 431 >SB_37261| Best HMM Match : rve (HMM E-Value=2.1e-08) Length = 757 Score = 27.5 bits (58), Expect = 8.9 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = +1 Query: 316 AAVCRAVRGPAGRTSVRL*CSRNAKDIRYSM*TRGCFVSRKHVLRR 453 A V ++GP G+ V + + NAK R + RG R HVLRR Sbjct: 585 AVVEELIQGPDGQHEVLVNANANAKRYRRKLIARGNEFPR-HVLRR 629 >SB_19312| Best HMM Match : DEP (HMM E-Value=2.5e-09) Length = 678 Score = 27.5 bits (58), Expect = 8.9 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = -2 Query: 435 SRHETASSSHRVANVLRVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSSPGALISG 256 +R S + N+ + P A +A T P + + GG +T+A +SS G + SG Sbjct: 75 ARRRPFSPKKSLGNLGKDPRA-RAQTLPDSESAPKEGAGGGPLTGKTIALSSSLGPVDSG 133 Query: 255 G 253 G Sbjct: 134 G 134 >SB_3798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +2 Query: 341 APPAGPVCAFDAAGTRRTFATLCELEAVSCRESTYYAVTSLGVC 472 +P + +C D RT+++ C L SC Y++ +G C Sbjct: 226 SPRSTEICGTDG----RTYSSFCALREHSCNVGRLYSIKHIGRC 265 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,517,151 Number of Sequences: 59808 Number of extensions: 465195 Number of successful extensions: 1461 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 1239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1459 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -