BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30074 (726 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 25 3.2 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 25 3.2 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 24 4.2 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 24 4.2 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 24 4.2 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 24 4.2 AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding pr... 24 5.5 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 7.3 AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding pr... 23 7.3 AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding pr... 23 7.3 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 7.3 AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 23 7.3 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 23 9.6 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 3.2 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -2 Query: 707 FNLVAKVCPVESLMCTMSKEPGCLSRDTMVPTRPKLRP 594 FN+ VC S+ PG + T+ PT LRP Sbjct: 73 FNIAIDVCDFPVNAKCESQSPGDQTTTTLRPTTTTLRP 110 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 3.2 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -2 Query: 707 FNLVAKVCPVESLMCTMSKEPGCLSRDTMVPTRPKLRP 594 FN+ VC S+ PG + T+ PT LRP Sbjct: 73 FNIAIDVCDFPVNAKCESQSPGDQTTTTLRPTTTTLRP 110 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.2 bits (50), Expect = 4.2 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -2 Query: 707 FNLVAKVCPVESLMCTMSKEPGCLSRDTMVPTRPKLRP 594 FN+ VC S+ PG + T+ PT LRP Sbjct: 73 FNVAIDVCDFPVNAKCESQSPGDQTTTTLRPTTTTLRP 110 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.2 bits (50), Expect = 4.2 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -2 Query: 707 FNLVAKVCPVESLMCTMSKEPGCLSRDTMVPTRPKLRP 594 FN+ VC S+ PG + T+ PT LRP Sbjct: 73 FNVAIDVCDFPVNAKCESQSPGDQTTTTLRPTTTTLRP 110 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.2 bits (50), Expect = 4.2 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -2 Query: 707 FNLVAKVCPVESLMCTMSKEPGCLSRDTMVPTRPKLRP 594 FN+ VC S+ PG + T+ PT LRP Sbjct: 73 FNVAIDVCDFPVNAKCESQSPGDQTTTTLRPTTTTLRP 110 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 24.2 bits (50), Expect = 4.2 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -2 Query: 707 FNLVAKVCPVESLMCTMSKEPGCLSRDTMVPTRPKLRP 594 FN+ VC S+ PG + T+ PT LRP Sbjct: 73 FNVAIDVCDFPVNAKCESQSPGDQTTTTLRPTTTTLRP 110 >AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding protein protein. Length = 155 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +2 Query: 62 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 208 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRPKISEEMANYPSQGIFPDDKEFKCY 81 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 7.3 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = +2 Query: 173 GDFPEESSEVCFDRKRSPENCETTPHKVDGKVRTDPTYPA 292 GD P F KRSP + + H +PT PA Sbjct: 1434 GDIPASKRMFAFVAKRSPSSADNQCHVF---CELEPTQPA 1470 >AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding protein AgamOBP6 protein. Length = 155 Score = 23.4 bits (48), Expect = 7.3 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +2 Query: 62 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 208 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDQEFKCY 81 >AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding protein AgamOBP18 protein. Length = 151 Score = 23.4 bits (48), Expect = 7.3 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +2 Query: 62 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 208 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 29 AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDKEFKCY 77 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.4 bits (48), Expect = 7.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 484 ADGAAIMRYQVRNILRSGRHTLDFTQLVLS 395 AD AA +RY + + RH L + Q ++S Sbjct: 483 ADTAAELRYAKEHADKENRHFLQYAQDLIS 512 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 23.4 bits (48), Expect = 7.3 Identities = 15/60 (25%), Positives = 22/60 (36%) Frame = -3 Query: 241 CFTIFRTSFPVKAYFRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLSNIHALGAFKRFKC 62 C + + PV +R R + RG +R+ PVD A +A KC Sbjct: 373 CISSIMEAMPVSVDRQRCYRCLERGHLARDCQSPVDRQQACIRCGADGHYAKSCTSEIKC 432 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 23.0 bits (47), Expect = 9.6 Identities = 18/74 (24%), Positives = 31/74 (41%) Frame = +2 Query: 59 EAFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCFDRKRSPENCE 238 E F+AL+++ +G + VC T+ S +A F SS+ F+ R + Sbjct: 337 ECFDALRKADIYAIGLIFWEVCRRTI--SCGIAEEYKVPYFDYVSSDPSFEEMRKVVCVD 394 Query: 239 TTPHKVDGKVRTDP 280 V + +DP Sbjct: 395 NYRPSVQNRWTSDP 408 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 841,385 Number of Sequences: 2352 Number of extensions: 19564 Number of successful extensions: 99 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -