BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30072 (656 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 1.9 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 3.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 4.5 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 7.8 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 7.8 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 398 LRVAPEXHPVLLTEAPLNPKANXEKM 475 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/35 (28%), Positives = 14/35 (40%) Frame = -1 Query: 266 SVPYDHHALMAGPSHDRGEHGARSIISCETGLAHT 162 + P+ HH+ A P H A S + HT Sbjct: 428 ATPHHHHSHAATPHHQHSTPLAHSSYPAAIQIGHT 462 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = +3 Query: 540 AVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHP 644 ++ +++HR C P +L +I + P HP Sbjct: 62 SLTAQAHHRLYPAFSSSCDPVPGNLEQIGSRPLHP 96 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 7.8 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +2 Query: 218 DRGKAPPSGRDGRMGQKDSYVGDEAXSXRGILTLKYPIEHGI 343 D K PPS R R+ ++Y + RG K + H I Sbjct: 403 DPAKFPPSFRISRVAAYNTYGRNAGLRYRGPKQNKPKVLHAI 444 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 Query: 162 GMCKAGFAGD 191 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,092 Number of Sequences: 438 Number of extensions: 3976 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -