BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30069 (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 24 3.7 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 23 6.4 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 24.2 bits (50), Expect = 3.7 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = +1 Query: 58 EALQKVLNRARELNIKFNKEKSSICCTEVKYLGDIFSQEGVKVDPSKV 201 E +K RE+ K N E S E+KYL I ++ K P V Sbjct: 325 EVQEKGRECVREILQKHNGEMSYDAVVEMKYLDQILNESLRKYPPVPV 372 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 23.4 bits (48), Expect = 6.4 Identities = 15/55 (27%), Positives = 30/55 (54%), Gaps = 4/55 (7%) Frame = -2 Query: 443 CNFFIGIILSQHWTICY--KQLNFI--KFSLFF**NPITIF*QK*SKKTVFFRQM 291 C F++ ++ SQ + CY ++++ KF+ F + F ++ S+ +FF QM Sbjct: 321 CGFYLLVMTSQVFIFCYVGNEISYTTDKFTEFVGFSNYFKFDKRTSQAMIFFLQM 375 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 614,761 Number of Sequences: 2352 Number of extensions: 11533 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -