BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30068 (763 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 27 0.22 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 23 2.0 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 3.5 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 3.5 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 6.1 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 6.1 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 6.1 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 6.1 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 6.1 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 6.1 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 6.1 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 6.1 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 26.6 bits (56), Expect = 0.22 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 135 RCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSP 230 R R VVPP C P+T+ P P D++ P Sbjct: 195 RSLRCVVPPTEDCDVPSTIPPPPPEEDDDSNIP 227 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 567 DVDIRKDLYANTVLSGGTTMYPGI 638 D D+ KD VL GG+T P I Sbjct: 150 DADMTKDQIDEIVLVGGSTRIPKI 173 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +1 Query: 52 GQQREDDPDHVRNIQHARHVRRHPSRA 132 GQ DP+ V + H+ HP +A Sbjct: 903 GQYTTKDPNEVTCDEEEGHISYHPDKA 929 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 433 ELPDGQVITIGNERFRCPEALFQPSSWVWKLAASTRPHI 549 E PD ++ F PE +F+P+++ LAA+ H+ Sbjct: 486 ERPDVKIFLPFRFLFYKPEDIFRPNTYNRFLAATGGDHV 524 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 102 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 239 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTTSQNLSSPASS 172 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 102 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 239 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 102 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 239 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 102 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 239 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 102 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 239 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 102 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 239 PP ++PS + + + P+S T P ++++ SP S Sbjct: 83 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 128 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 102 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 239 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 102 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 239 PP ++PS + + + P+S T P ++++ SP S Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,363 Number of Sequences: 336 Number of extensions: 4966 Number of successful extensions: 18 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -