BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30065 (679 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 115 3e-26 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 102 3e-22 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 102 3e-22 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 102 3e-22 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 7e-22 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 7e-22 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 7e-22 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 7e-22 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 7e-22 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 7e-22 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 101 7e-22 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 7e-22 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 9e-22 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 100 2e-21 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 3e-21 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 99 4e-21 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 99 4e-21 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 99 4e-21 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 99 4e-21 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 5e-21 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 7e-21 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 98 7e-21 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 98 7e-21 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 98 7e-21 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 98 7e-21 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 7e-21 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 7e-21 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 7e-21 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 7e-21 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 7e-21 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 98 7e-21 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 7e-21 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 98 7e-21 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 7e-21 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 98 7e-21 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 7e-21 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 7e-21 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 7e-21 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 98 7e-21 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 7e-21 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 97 9e-21 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 97 9e-21 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 97 9e-21 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 97 9e-21 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 97 9e-21 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 97 9e-21 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 97 9e-21 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 97 9e-21 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 97 9e-21 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 97 9e-21 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 97 9e-21 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 97 9e-21 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 97 9e-21 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 97 9e-21 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 97 9e-21 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 97 9e-21 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 97 9e-21 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 97 9e-21 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 97 9e-21 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 97 9e-21 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 97 9e-21 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 97 9e-21 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 97 9e-21 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 97 9e-21 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 97 9e-21 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 97 9e-21 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 97 9e-21 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 97 9e-21 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 97 9e-21 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 97 9e-21 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 97 9e-21 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 97 9e-21 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 97 9e-21 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 97 9e-21 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 97 9e-21 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 97 9e-21 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 97 9e-21 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 97 9e-21 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 97 1e-20 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 97 1e-20 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 97 1e-20 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 97 1e-20 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 97 1e-20 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 97 1e-20 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 97 1e-20 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 97 1e-20 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 97 1e-20 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 97 1e-20 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 97 1e-20 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 97 1e-20 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 97 1e-20 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 97 1e-20 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 97 1e-20 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 97 1e-20 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 97 1e-20 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 97 1e-20 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 97 1e-20 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 97 1e-20 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 97 1e-20 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 97 1e-20 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 97 1e-20 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 97 1e-20 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 97 1e-20 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 97 1e-20 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 97 1e-20 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 97 1e-20 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 97 1e-20 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 97 1e-20 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 97 1e-20 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 97 1e-20 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 97 1e-20 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 97 1e-20 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 3e-20 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 3e-20 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 95 4e-20 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 95 4e-20 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 95 4e-20 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 95 4e-20 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 95 4e-20 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 95 4e-20 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 95 4e-20 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 95 4e-20 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 95 4e-20 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 95 4e-20 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 95 4e-20 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 95 4e-20 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 95 4e-20 SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) 95 4e-20 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 95 4e-20 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 95 4e-20 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 95 4e-20 SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_16189| Best HMM Match : rve (HMM E-Value=0.3) 95 4e-20 SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) 95 4e-20 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) 95 4e-20 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) 95 4e-20 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 95 4e-20 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023) 95 4e-20 SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 95 4e-20 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 95 4e-20 SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 115 bits (277), Expect = 3e-26 Identities = 51/59 (86%), Positives = 51/59 (86%) Frame = -1 Query: 388 QXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPVNCNTTHYRANW 212 Q RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF K RPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 102 bits (244), Expect = 3e-22 Identities = 50/67 (74%), Positives = 52/67 (77%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPVNCNT 233 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSW GF K RPVNCNT Sbjct: 587 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNT 641 Query: 232 THYRANW 212 THYRANW Sbjct: 642 THYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 102 bits (244), Expect = 3e-22 Identities = 50/67 (74%), Positives = 52/67 (77%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPVNCNT 233 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSW GF K RPVNCNT Sbjct: 30 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNT 84 Query: 232 THYRANW 212 THYRANW Sbjct: 85 THYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 102 bits (244), Expect = 3e-22 Identities = 50/67 (74%), Positives = 52/67 (77%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPVNCNT 233 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSW GF K RPVNCNT Sbjct: 30 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNT 84 Query: 232 THYRANW 212 THYRANW Sbjct: 85 THYRANW 91 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 101 bits (241), Expect = 7e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPV 245 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK RPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 101 bits (241), Expect = 7e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPV 245 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK RPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 101 bits (241), Expect = 7e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPV 245 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK RPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 101 bits (241), Expect = 7e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPV 245 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK RPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 101 bits (241), Expect = 7e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPV 245 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK RPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 101 bits (241), Expect = 7e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPV 245 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK RPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) Length = 629 Score = 101 bits (241), Expect = 7e-22 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = -1 Query: 406 NLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPVN 242 +L ++I+ RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT N Sbjct: 457 SLFYSIRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTARN 511 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 101 bits (241), Expect = 7e-22 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPV 245 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK RPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 100 bits (240), Expect = 9e-22 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = -1 Query: 424 QNIXAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 +++ + P+ + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 518 ESVSRNSTPYTQRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 574 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 100 bits (239), Expect = 1e-21 Identities = 47/56 (83%), Positives = 50/56 (89%) Frame = -1 Query: 421 NIXAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 N+ A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 440 NMGASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 493 >SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) Length = 73 Score = 99.5 bits (237), Expect = 2e-21 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRP 248 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT P Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTP 47 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 99.1 bits (236), Expect = 3e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 P A + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 52 PQAPRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 100 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 98.7 bits (235), Expect = 4e-21 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = +3 Query: 246 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSXEARTDRPSQQLR 383 TGR LQRRDWENPGVTQLNRLAAHPPFASWRNS EARTDRPSQQLR Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 60 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 98.7 bits (235), Expect = 4e-21 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -1 Query: 388 QXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 Q RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 932 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 98.7 bits (235), Expect = 4e-21 Identities = 52/79 (65%), Positives = 58/79 (73%), Gaps = 1/79 (1%) Frame = -1 Query: 487 ADXGLLVXK*ADLTKIXREF*QNIX-AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCA 311 A G+L + L + EF + A + PF + RNCWEGRSVRASSLLRQLAKGGCA Sbjct: 151 ASEGMLTVASSALCNLLLEFSPSKEGASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCA 208 Query: 310 ARRLSWVTPGFSQSRRCKT 254 ARRLSWVTPGFSQSRRCKT Sbjct: 209 ARRLSWVTPGFSQSRRCKT 227 Score = 91.9 bits (218), Expect = 4e-19 Identities = 41/43 (95%), Positives = 41/43 (95%) Frame = +3 Query: 255 VLQRRDWENPGVTQLNRLAAHPPFASWRNSXEARTDRPSQQLR 383 VLQRRDWEN GVTQLNRLAAHPPFASWRNS EARTDRPSQQLR Sbjct: 518 VLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 560 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 98.7 bits (235), Expect = 4e-21 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = +3 Query: 246 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSXEARTDRPSQQLR 383 TGR LQRRDWENPGVTQLNRLAAHPPFASWRNS EARTDRPSQQLR Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 98.7 bits (235), Expect = 4e-21 Identities = 45/52 (86%), Positives = 46/52 (88%) Frame = -1 Query: 409 YNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 + PFAIQ WEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 59 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 98.7 bits (235), Expect = 4e-21 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = +3 Query: 246 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSXEARTDRPSQQLR 383 TGR LQRRDWENPGVTQLNRLAAHPPFASWRNS EARTDRPSQQLR Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 70 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 98.7 bits (235), Expect = 4e-21 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = +3 Query: 246 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSXEARTDRPSQQLR 383 TGR LQRRDWENPGVTQLNRLAAHPPFASWRNS EARTDRPSQQLR Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 98.7 bits (235), Expect = 4e-21 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = +3 Query: 246 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSXEARTDRPSQQLR 383 TGR LQRRDWENPGVTQLNRLAAHPPFASWRNS EARTDRPSQQLR Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 117 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 98.7 bits (235), Expect = 4e-21 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -1 Query: 391 IQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 I+ RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 239 IRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 284 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 98.7 bits (235), Expect = 4e-21 Identities = 45/52 (86%), Positives = 48/52 (92%), Gaps = 2/52 (3%) Frame = -1 Query: 403 LPFA--IQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 +PF ++ RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 92 IPFVALLKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 143 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 98.7 bits (235), Expect = 4e-21 Identities = 45/52 (86%), Positives = 46/52 (88%) Frame = -1 Query: 409 YNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 + PFAIQ WEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 59 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 98.7 bits (235), Expect = 4e-21 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -1 Query: 388 QXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 Q RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 164 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 208 Score = 95.1 bits (226), Expect = 5e-20 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 255 VLQRRDWENPGVTQLNRLAAHPPFASWRNSXEARTDRPSQQLR 383 VLQRRDWENPGVTQLNRLAAHPPFASWRNS EARTDRPSQQLR Sbjct: 52 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94 >SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 98.7 bits (235), Expect = 4e-21 Identities = 48/68 (70%), Positives = 51/68 (75%), Gaps = 3/68 (4%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT---RPVNCNTTHYRANW 212 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT + C R + Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSP 62 Query: 211 VPGPPSSF 188 + GP F Sbjct: 63 ICGPTQKF 70 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 98.7 bits (235), Expect = 4e-21 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = -1 Query: 418 IXAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 + A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 175 VGASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 227 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 98.3 bits (234), Expect = 5e-21 Identities = 47/72 (65%), Positives = 52/72 (72%) Frame = -1 Query: 445 KIXREF*QNIXAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSR 266 K + F N + + + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSR Sbjct: 202 KNSKRFQGNSQSSKYCISAKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSR 261 Query: 265 RCKTRPVNCNTT 230 RCKT N + Sbjct: 262 RCKTTASELNVS 273 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 52 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 214 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 264 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 369 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 419 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 285 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 335 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/67 (68%), Positives = 49/67 (73%) Frame = -1 Query: 454 DLTKIXREF*QNIXAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFS 275 D+ + +F Y RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFS Sbjct: 384 DIVEAIVQFGPGCFLYKRDLRQALRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFS 443 Query: 274 QSRRCKT 254 QSRRCKT Sbjct: 444 QSRRCKT 450 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 52 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 52 Score = 95.1 bits (226), Expect = 5e-20 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 255 VLQRRDWENPGVTQLNRLAAHPPFASWRNSXEARTDRPSQQLR 383 VLQRRDWENPGVTQLNRLAAHPPFASWRNS EARTDRPSQQLR Sbjct: 88 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 130 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 52 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 52 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 25 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 75 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 30 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 80 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 97.9 bits (233), Expect = 7e-21 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -1 Query: 391 IQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 ++ RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 53 LRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 98 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 259 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 309 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 97.9 bits (233), Expect = 7e-21 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -1 Query: 391 IQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 I RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 127 ITLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 172 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 278 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 328 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 128 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 178 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 52 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 52 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 579 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 629 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 97.9 bits (233), Expect = 7e-21 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 412 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 493 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 543 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 474 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 520 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 67 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 113 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 648 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 694 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 557 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 603 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 97.5 bits (232), Expect = 9e-21 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = -1 Query: 391 IQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 I RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 295 ILLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 340 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 13 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 59 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 190 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 236 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 916 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 962 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1090 Score = 97.5 bits (232), Expect = 9e-21 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = -1 Query: 394 AIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 A + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 444 AHRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 490 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 264 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 310 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/51 (88%), Positives = 47/51 (92%), Gaps = 1/51 (1%) Frame = -1 Query: 403 LPFAIQX-RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 +P A+ RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 76 MPEAVSGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 126 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 Score = 66.9 bits (156), Expect = 1e-11 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 384 CATVGKGDRCGPXRYYASWRKGDVLQGD 301 CATVGKGDRCGP RYYASWRKGDVLQGD Sbjct: 91 CATVGKGDRCGPLRYYASWRKGDVLQGD 118 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 70 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 116 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 97.5 bits (232), Expect = 9e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = -1 Query: 400 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 PF + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 67 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 148 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 190 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 225 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 267 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 369 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 411 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 226 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 268 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 359 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 401 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 35 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 77 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 791 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 833 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 452 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 494 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 373 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 415 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 1107 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 1149 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 112 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 154 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 22 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 64 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 269 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 311 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 488 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 530 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 253 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 295 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 96 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 138 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 52 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 94 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 157 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 199 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) Length = 446 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 40 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 82 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 57 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 99 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 120 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 162 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 382 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 254 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 45 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,018,562 Number of Sequences: 59808 Number of extensions: 392997 Number of successful extensions: 4721 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4696 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -