Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30065
         (679 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC024826-14|AAF60791.1|  332|Caenorhabditis elegans Mrna decappi...    30   1.3  

>AC024826-14|AAF60791.1|  332|Caenorhabditis elegans Mrna decapping
           enzyme protein 1 protein.
          Length = 332

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +1

Query: 283 LALPNLIALQHIPLSPAGVIAXRP-APIALPNSCAXEWRMANCKRXYFV 426
           LA  NL  LQ I ++ + ++   P A I   ++   EW  +NC+  +FV
Sbjct: 12  LAAKNLAQLQKIDIAASKILDKMPFAAIYHIDAARKEWNQSNCEGTFFV 60


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,754,548
Number of Sequences: 27780
Number of extensions: 293140
Number of successful extensions: 585
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 576
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 585
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1539654388
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)