BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30063 (773 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z74043-7|CAA98539.2| 705|Caenorhabditis elegans Hypothetical pr... 30 1.6 AL031635-4|CAA21043.2| 269|Caenorhabditis elegans Hypothetical ... 28 6.4 >Z74043-7|CAA98539.2| 705|Caenorhabditis elegans Hypothetical protein T19B10.5 protein. Length = 705 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/58 (25%), Positives = 30/58 (51%) Frame = -3 Query: 753 HIWNVFRKNKQIGVPRTFPRKVPPDAPCSGALSAAGVVVTRSVTATLASAPSARSFRF 580 ++W+ + K+ + +T PP A SG + + +T +VTAT+ PS + ++ Sbjct: 617 NVWSRLYQEKKGNLRKTRDVSSPPTAHTSGIPTPSRSSITSTVTATVGKTPSTDNEKY 674 >AL031635-4|CAA21043.2| 269|Caenorhabditis elegans Hypothetical protein Y47D3B.6 protein. Length = 269 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +1 Query: 139 IPLSPAGVIAKRPAPIALPNS-CAPAM 216 IP++PA V+A R P ALP S C P + Sbjct: 145 IPVAPAPVVAGRLIPQALPGSPCEPGV 171 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,522,393 Number of Sequences: 27780 Number of extensions: 363263 Number of successful extensions: 888 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 888 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1861650246 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -