BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30060 (814 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 72 5e-13 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 51 1e-06 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) 40 0.002 SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 38 0.010 SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 38 0.010 SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 38 0.010 SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 38 0.010 SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 38 0.010 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 38 0.010 SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 38 0.010 SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 38 0.010 SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 38 0.010 SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_33090| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 38 0.010 SB_21833| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) 38 0.010 SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 38 0.013 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 37 0.017 SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 37 0.022 SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_33363| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 36 0.039 SB_49373| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_32953| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 36 0.052 SB_41893| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_37312| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) 36 0.052 SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.090 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 35 0.090 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.090 SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.090 SB_48951| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.090 SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.090 SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_57449| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_53282| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 34 0.16 SB_29925| Best HMM Match : GYF (HMM E-Value=6.8) 34 0.16 SB_7768| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_59162| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_58689| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_58471| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_57504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_57309| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_57160| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_57088| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_57000| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_56985| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_56864| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_56097| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_55911| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_55353| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_54657| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_54057| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_53941| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_53667| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_53456| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_53229| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_52843| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_51637| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_51120| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_51074| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_51032| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_51007| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_50996| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_50982| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_50953| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_50936| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_50384| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_50220| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_49746| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_49667| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_49638| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_49334| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_49116| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_49113| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_49028| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_48983| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_48970| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_48539| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_48364| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_47957| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_47808| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_47385| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_47361| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_47000| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_46654| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_46429| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_46359| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_46213| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_45478| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_45234| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_44852| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_44662| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_43993| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_43758| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_43593| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_43340| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_43144| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_43093| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_42443| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_42383| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_42278| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_42126| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_41977| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_40549| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_40449| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_40443| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_40197| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_39975| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_39947| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_39754| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_39490| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_38568| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_38390| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_38374| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_38338| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_38296| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_37924| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_37621| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_37575| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_37514| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_36927| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_36111| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_35639| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_35629| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_35549| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_35413| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_35273| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_35215| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_35079| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_34965| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_34867| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_34812| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_34787| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_34475| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_34273| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_34020| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_34019| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_33900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_33633| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_33156| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_33065| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_32699| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_32249| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_31827| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_31689| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_31560| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_31456| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_31442| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_31298| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_31283| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_31155| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_31061| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_30878| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_29626| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_29443| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_28945| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_28854| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_28678| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_28435| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_27744| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_27513| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_27344| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_26541| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_26180| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_26102| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_26045| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_25987| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_25886| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_24955| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_24149| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_24008| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_23901| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_23701| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_23491| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_23324| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_23308| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_23301| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_23277| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_22929| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_22512| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_22481| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_22451| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_21947| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_21159| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_21030| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_20944| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_20880| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_20832| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_20742| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_20690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_20420| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_20060| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_20036| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_19743| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_19490| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_19448| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_18813| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_18603| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_18478| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_18315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_17938| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_17616| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_17417| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_17352| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_17230| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_16690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_16230| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_15921| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_15429| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_15370| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_14040| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_13500| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_12864| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_12842| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_12053| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_12049| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_11704| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_11587| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_10981| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_10838| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_10043| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_9790| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_9789| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_9564| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_9236| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_9227| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_9169| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_8203| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_8131| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_7699| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_7316| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_7204| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_6994| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_6265| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_6232| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_6109| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_6103| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_5995| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_5987| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_5937| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_5666| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_5533| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_4915| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_4853| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_4538| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_4213| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_4133| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_3630| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_3555| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_3396| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_3272| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_3008| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_2936| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_2741| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_2242| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_1859| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_1767| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_1708| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_1630| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_1626| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_1413| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_1202| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 72.1 bits (169), Expect = 5e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +1 Query: 7 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 72.1 bits (169), Expect = 5e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +1 Query: 7 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 72.1 bits (169), Expect = 5e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +1 Query: 7 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 80 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 119 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.8 bits (131), Expect = 2e-08 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +1 Query: 7 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 TAGR + ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRVAMEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 28 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 9 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 41 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 28 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 28 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 34 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 34 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 34 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 34 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 34 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 34 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 34 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 34 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 34 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 34 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 34 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 126 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 10 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 37 SAKECATTHLPKQPALKMDGAEAFCLYTTV 126 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 37 SAKECATTHLPKQPALKMDGAEAFCLYTTV 126 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 37 SAKECATTHLPKQPALKMDGAEAFCLYTTV 126 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 37 SAKECATTHLPKQPALKMDGAEAFCLYTTV 126 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +1 Query: 40 AKECATTHLPKQPALKMDGAEAFCLYTTV 126 AKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 39 AKECVTTHLPKQLALKMDGAQASHLYRAV 67 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.4 bits (100), Expect = 1e-04 Identities = 31/62 (50%), Positives = 34/62 (54%), Gaps = 3/62 (4%) Frame = -1 Query: 343 DRLTREQLLFTRNPSPRQSSRASLEYLLLPQDLHRRRLQAAHAQTLLRSPSRT---SYSL 173 DRLT QLLFT N SP +SS+ S EYLLLP R L+A Q R T SYS Sbjct: 89 DRLTHVQLLFTWNLSPLRSSKLSFEYLLLPP---RSALEAVFTQARARGCVTTPTPSYSS 145 Query: 172 RL 167 L Sbjct: 146 EL 147 Score = 35.9 bits (79), Expect = 0.039 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMR 636 YLH S+ R L L TCCGY Y+ R SP F + + RTP + R Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEDR 90 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +1 Query: 43 KECATTHLPKQPALKMDGAEAFCLYTTV 126 KEC TT LPKQ ALKMDGA+A LY V Sbjct: 40 KECVTTPLPKQLALKMDGAQASHLYRAV 67 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 8 QQDGGHGSRNPLR 46 QQDGGHGS NPL+ Sbjct: 28 QQDGGHGSWNPLK 40 >SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP+F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPDFQGSSRAHRTPQEVWC 102 >SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) Length = 106 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMTRALH-LGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ + LH L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLHTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP FS ++ + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFSGASRAHRTPQEVWC 91 >SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 56 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 103 >SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +1 Query: 28 KSESAKECATTHLPKQPALKM 90 K ESAKEC TTHLPKQ ALKM Sbjct: 2 KVESAKECVTTHLPKQLALKM 22 >SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 56 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 103 >SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 91 >SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 91 >SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 91 >SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 107 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 154 >SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 91 >SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/50 (44%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F S+ RTP ++ C Sbjct: 94 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRVHRTPQEVWC 141 >SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLKLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 11 YLHVSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 58 >SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 93 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 140 >SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 93 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 140 >SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 128 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 175 >SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 56 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 50 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 97 >SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 56 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 27 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 74 >SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 10 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 57 >SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 128 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 175 >SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 56 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 128 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 175 >SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 62 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 109 >SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 56 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 56 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 197 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 244 >SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 65 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 112 >SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 10 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 57 >SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 93 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 140 >SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 17 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 64 >SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVCC 102 >SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 56 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 218 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 167 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 214 >SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 128 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 175 >SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 127 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 174 >SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 11 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 58 >SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 128 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 175 >SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 56 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 10 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 57 >SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 76 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 123 >SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) Length = 321 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 270 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 317 >SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 166 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 213 >SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 62 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 109 >SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_33090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/46 (41%), Positives = 24/46 (52%) Frame = -3 Query: 770 YSMTRALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 Y R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 36 YDQKRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 79 >SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 166 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 213 >SB_21833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 37.9 bits (84), Expect = 0.010 Identities = 19/46 (41%), Positives = 24/46 (52%) Frame = -3 Query: 770 YSMTRALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 Y R L L TCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 36 YDQKRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 79 >SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) Length = 204 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 153 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 200 >SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 93 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 140 >SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 54 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 101 >SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 94 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 141 >SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 93 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 140 >SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 44 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 37.5 bits (83), Expect = 0.013 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSS 627 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP + S+ Sbjct: 207 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEALTSA 256 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 37.1 bits (82), Expect = 0.017 Identities = 21/47 (44%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQ 642 YLH S+ R L L TCCGY Y+ R SP F S+ + RTP + Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQE 99 >SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.1 bits (82), Expect = 0.017 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH S+ R L L TCCGY Y R SP F + + RTP ++ C Sbjct: 55 YLHCSINQRLLTLETCCGYEYNRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) Length = 237 Score = 36.7 bits (81), Expect = 0.022 Identities = 23/57 (40%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRSEPY 612 YLH S+ R L L TCCGY Y+ R SP F + + RTP + + R PY Sbjct: 55 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQE---TGRMRPY 106 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/67 (31%), Positives = 29/67 (43%) Frame = -1 Query: 814 PKLRNPICRLPFTYIIL*LELFTLEPAADMGTNRRDISTYIPHLNFQGPQRVSGHRRKCG 635 PKLR P+ + + L TLE +R S P NFQGP R ++ G Sbjct: 44 PKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSRAHRTPQETG 101 Query: 634 ALRVPNH 614 +R +H Sbjct: 102 RMRPYDH 108 >SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.7 bits (81), Expect = 0.022 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 YLH ++ R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 68 YLHCAINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 115 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 36.3 bits (80), Expect = 0.030 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMR 636 YLH S+ R L L TCCGY Y+ R SP F + + RTP + R Sbjct: 93 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQENR 139 >SB_33363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/46 (39%), Positives = 23/46 (50%) Frame = -3 Query: 770 YSMTRALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 Y R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 35 YGQKRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 78 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 35.9 bits (79), Expect = 0.039 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -3 Query: 779 YLHYSMT-RALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSR 624 YLH S+ R L L TCCGY Y+ R SP F + + RTP ++ R Sbjct: 160 YLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEICTGGR 210 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = -1 Query: 814 PKLRNPICRLPFTYIIL*LELFTLEPAADMGTNRRDISTYIPHLNFQGPQR 662 P++ + CRLP+ + + L TLE +R S P NFQGP R Sbjct: 149 PEVTDLFCRLPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSR 197 >SB_49373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/46 (39%), Positives = 23/46 (50%) Frame = -3 Query: 770 YSMTRALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 Y R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 52 YGQKRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 95 >SB_32953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/46 (39%), Positives = 23/46 (50%) Frame = -3 Query: 770 YSMTRALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 633 Y R L L TCCGY Y+ R SP F + + RTP ++ C Sbjct: 53 YGQKRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 96 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,437,270 Number of Sequences: 59808 Number of extensions: 625345 Number of successful extensions: 4137 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3232 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3405 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2263654701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -