BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30053 (762 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 28 1.7 SPBC24C6.07 |cdc14||SIN component Cdc14|Schizosaccharomyces pomb... 27 2.2 SPBC1703.04 |mlh1||MutL family protein Mlh1 |Schizosaccharomyces... 26 5.1 SPAC30C2.06c |dml1||mitochondrial genome maintenance protein |Sc... 26 6.7 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 27.9 bits (59), Expect = 1.7 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = -1 Query: 255 PFAPSTAHISTCLSIFCASCASNEN--FMVILLPHLAICGNYRYR*EGQSCHHPPPVL 88 P+ S T L C C E F+ L+PH CG+ + GQ C HP P+L Sbjct: 244 PYCQSN-QTETSLHYLCW-CGKQEKPEFVKNLVPHS--CGDPCGKTRGQDCEHPCPLL 297 >SPBC24C6.07 |cdc14||SIN component Cdc14|Schizosaccharomyces pombe|chr 2|||Manual Length = 240 Score = 27.5 bits (58), Expect = 2.2 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +1 Query: 295 KRAIRLTVKLLKPSRKSARELAAMKS 372 K +RL + LL+PS+ S ++AAMK+ Sbjct: 115 KATLRLFIHLLQPSQPSMLQVAAMKT 140 >SPBC1703.04 |mlh1||MutL family protein Mlh1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 684 Score = 26.2 bits (55), Expect = 5.1 Identities = 15/60 (25%), Positives = 29/60 (48%), Gaps = 6/60 (10%) Frame = +3 Query: 267 NIRSRKLTLKKGDPANCEVVKTIQK------KCKRTCRYEKSSWSECSINGEMSRTDKLK 428 N+RSRK LK G ++ +QK + C+ + + S++ +S+ DK++ Sbjct: 166 NVRSRKSALKNGSEEFRRIMILVQKYAIHNDQVSFNCKKVGDTVASLSLSSRLSKADKIR 225 >SPAC30C2.06c |dml1||mitochondrial genome maintenance protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 465 Score = 25.8 bits (54), Expect = 6.7 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 456 FGRKSNRCWT 427 FGRKSN CWT Sbjct: 9 FGRKSNFCWT 18 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,847,389 Number of Sequences: 5004 Number of extensions: 55638 Number of successful extensions: 157 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 157 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 365309308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -