BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30053 (762 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 3.1 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 22 5.4 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 22 5.4 AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. 22 7.1 AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. 22 7.1 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +3 Query: 219 GMSIC--ARCLERMDSKTNIRSRKLTLKKGDPANCE 320 G S+C + LER+ + N + K+T+K N E Sbjct: 129 GSSLCDLVQGLERLFDEKNAGNNKITMKSKKEQNAE 164 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 495 LAYSCYISEFCAYFGRKSNRCWTLAYR 415 L+Y+C + C R+ NRC Y+ Sbjct: 142 LSYACREEKSCIIDKRQRNRCQYCRYQ 168 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 495 LAYSCYISEFCAYFGRKSNRCWTLAYR 415 L+Y+C + C R+ NRC Y+ Sbjct: 142 LSYACREEKSCIIDKRQRNRCQYCRYQ 168 >AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 21.8 bits (44), Expect = 7.1 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +3 Query: 423 LKSNSDSTCDQSRRKTRKCNKNKQVKLAKIRVAEIAS 533 + S+ D+ DQ+ T + K Q A +R E+AS Sbjct: 10 ISSSDDNRIDQATGLTERQKKLVQNTWAVVRKDEVAS 46 >AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 21.8 bits (44), Expect = 7.1 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +3 Query: 423 LKSNSDSTCDQSRRKTRKCNKNKQVKLAKIRVAEIAS 533 + S+ D+ DQ+ T + K Q A +R E+AS Sbjct: 10 ISSSDDNRIDQATGLTERQKKLVQNTWAVVRKDEVAS 46 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,044 Number of Sequences: 438 Number of extensions: 4763 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -