BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30048 (303 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 2.1 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 20 5.0 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.4 bits (43), Expect = 2.1 Identities = 7/39 (17%), Positives = 20/39 (51%) Frame = -1 Query: 303 FFFFFFPLNKSYGTIQARHFTILGAKVLISLLC*NLLDF 187 +++ FF ++ +YG + + K + LC + +++ Sbjct: 116 YYYAFFGVHLAYGVVIIYSICVQTEKSVFDFLCRHTVEY 154 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 20.2 bits (40), Expect = 5.0 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 288 FPLNKSYGTIQARHFTILGAKVLISLL 208 FPLN + HFT KVL + L Sbjct: 41 FPLNHLNEEPEKLHFTFKSWKVLYTSL 67 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,949 Number of Sequences: 336 Number of extensions: 1222 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5412171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -