SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30045
         (396 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine hydroxy...    24   0.48 
AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    23   0.83 
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    21   4.4  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    21   4.4  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    21   4.4  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    21   4.4  

>EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine
           hydroxylase protein.
          Length = 532

 Score = 24.2 bits (50), Expect = 0.48
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = -1

Query: 348 HTLKGECRHMLLHHWPXLXESS 283
           HT + +C H LL H P L + S
Sbjct: 352 HTPEPDCIHELLGHMPLLADPS 373


>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 23.4 bits (48), Expect = 0.83
 Identities = 11/35 (31%), Positives = 15/35 (42%)
 Frame = -2

Query: 335 VNADICCCTIGXXSXNPLNVYNKLFTITCITLPTC 231
           +N+ IC C  G    N  N  N   +  C+   TC
Sbjct: 42  INSYICTCKPGFTGSNCQNRINLCDSSPCLNGATC 76


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 4.4
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +2

Query: 302 GQWCNSICRHSP 337
           G W N I RHSP
Sbjct: 266 GWWENYISRHSP 277


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 4.4
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +2

Query: 302 GQWCNSICRHSP 337
           G W N I RHSP
Sbjct: 266 GWWENYISRHSP 277


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 4.4
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +2

Query: 302 GQWCNSICRHSP 337
           G W N I RHSP
Sbjct: 266 GWWENYISRHSP 277


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 4.4
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +2

Query: 302 GQWCNSICRHSP 337
           G W N I RHSP
Sbjct: 266 GWWENYISRHSP 277


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 85,835
Number of Sequences: 336
Number of extensions: 1669
Number of successful extensions: 7
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 51
effective length of database: 105,449
effective search space used:  8435920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -