BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30043 (815 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33339| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.15) 29 3.4 SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 3.4 >SB_33339| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.15) Length = 1224 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 Query: 316 SVKLLIGCSCSLAFYLFTFTSDSCGFSTSPRSF 218 S KL IGC C+L + +T GF TS + F Sbjct: 52 SQKLAIGCMCALEVFRQLYTGPLKGFHTSLQGF 84 >SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1080 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +3 Query: 138 KAKGVSGLIEVENPNRVV 191 K GV LIE+ENPNRV+ Sbjct: 136 KPTGVQALIEIENPNRVL 153 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,361,209 Number of Sequences: 59808 Number of extensions: 237705 Number of successful extensions: 459 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 459 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2275631710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -