BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30039 (772 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 23 2.0 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 23 2.7 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 23 3.6 DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 22 6.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 6.2 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 8.2 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -1 Query: 715 WCSWALNVEITAADVIDGFIVDHESTVRVLKGCVGGE 605 W + ALN + +V F++ E +R ++ VG E Sbjct: 151 WATDALNPSVYTYEVSPVFVLMEEVVLREMRAIVGFE 187 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/27 (33%), Positives = 11/27 (40%) Frame = -2 Query: 420 QRACGFCPKPNLRFPFQWCSDHGHSCW 340 Q C + PN C+D SCW Sbjct: 15 QLECNWSSGPNATLQSSACTDDLSSCW 41 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 22.6 bits (46), Expect = 3.6 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 345 NYARGHYTIGKEIVDLVLDRIRKLADQCTG 434 +YAR G IVD+ LD R L CTG Sbjct: 392 SYARAKGLGGIAIVDITLDDFRGL---CTG 418 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 233 RGTCLPAPVSLKKVLKES 180 RGTC P LKK L ++ Sbjct: 53 RGTCSPDGEELKKALPDA 70 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 6.2 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 686 YGGRCHRWLHC 654 Y G C R+LHC Sbjct: 1287 YPGDCTRYLHC 1297 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.4 bits (43), Expect = 8.2 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 666 SMTSAAVISTLSAQLHQPESSHRTDC 743 S + A+V S SA LH P DC Sbjct: 41 SGSPASVASNASAPLHIPAKRAAYDC 66 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,501 Number of Sequences: 336 Number of extensions: 4145 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20753800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -