BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30038 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription fact... 25 1.7 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 25 2.2 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 3.0 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 5.2 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 23 9.0 >AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription factor protein. Length = 391 Score = 25.4 bits (53), Expect = 1.7 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = +2 Query: 200 YSQFRYRTNTESPVTLFWV*RTRRVREQKHTVLR 301 Y Q R NT++P W+ ++++E + T ++ Sbjct: 330 YQQLEERGNTDNPDVARWLEWRKKIKEYRMTAMK 363 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 25.0 bits (52), Expect = 2.2 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +2 Query: 413 NGFNKANWNSTVDG--TKVIFSYLSK 484 N FN ANW + D +K + SYL K Sbjct: 648 NAFNTANWQAIADALQSKNVPSYLMK 673 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 428 ANWNSTVDGTKVIFSYLSKDGEEGYPG 508 A W+ +DG L D ++GYPG Sbjct: 1806 AGWDGVLDGIINEEDCLPPDNDKGYPG 1832 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 266 RRVREQKHTVLRDHGRPLCQQDRRTKFSID 355 RR++EQ H + +D+ P R+ K + D Sbjct: 30 RRIKEQLHQLEQDNESPTHMYRRKLKIASD 59 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -3 Query: 106 PQHSKSPCLLFKTNDSSGHKTIKKTI 29 P H K C F +SSG KK I Sbjct: 82 PGHKKRDCKEFLNRESSGEGEKKKKI 107 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 699,757 Number of Sequences: 2352 Number of extensions: 14063 Number of successful extensions: 25 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -