BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30033 (326 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 5.0 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 20 8.8 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 20 8.8 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 20 8.8 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 20 8.8 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 20 8.8 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 20.6 bits (41), Expect = 5.0 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -3 Query: 195 FDSTYIPR*PNR 160 +DSTYIP+ N+ Sbjct: 321 YDSTYIPKVKNK 332 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 19.8 bits (39), Expect = 8.8 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 74 FWVTPF 91 FWVTPF Sbjct: 180 FWVTPF 185 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 19.8 bits (39), Expect = 8.8 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -3 Query: 54 NNNESGFSFL 25 N+NE GFS+L Sbjct: 23 NDNEFGFSYL 32 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 19.8 bits (39), Expect = 8.8 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 74 FWVTPF 91 FWVTPF Sbjct: 180 FWVTPF 185 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 19.8 bits (39), Expect = 8.8 Identities = 8/32 (25%), Positives = 19/32 (59%) Frame = -3 Query: 156 EKHDETSVCMLLIFKSIIDNSKNGVTQNRIIS 61 ++HD+ + ++ F + +KNG + N +I+ Sbjct: 473 DEHDDAFIGIVNQFHILQFITKNGTSNNYLIN 504 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 19.8 bits (39), Expect = 8.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 238 KHKKMPNLVTAIHNF 194 +H K PNLV + F Sbjct: 863 RHWKFPNLVEVLDEF 877 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,602 Number of Sequences: 438 Number of extensions: 1561 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7217694 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -