Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30030
         (349 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_04_0340 - 16536571-16536705,16536820-16536951,16537265-165381...    28   1.8  

>11_04_0340 - 16536571-16536705,16536820-16536951,16537265-16538106,
            16538480-16538940,16539032-16540314,16540423-16541627,
            16541857-16542157
          Length = 1452

 Score = 28.3 bits (60), Expect = 1.8
 Identities = 17/70 (24%), Positives = 28/70 (40%)
 Frame = +1

Query: 7    LNILHLFKIKSIMYFLKYFIVVLVALSLMICSGQADPKIPVKSLKKGGKVIAKGFKVLTA 186
            L ++HL  +K ++      +V++   SL  CSG   P + + +          G   LT 
Sbjct: 946  LELVHLHAVKELLVLPLEKLVLIKMASLEYCSGLTSPSLQISTSLGDRNESLSGLHDLTI 1005

Query: 187  AGTAHEVYSH 216
                  V SH
Sbjct: 1006 HDCPRLVVSH 1015


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,608,288
Number of Sequences: 37544
Number of extensions: 133886
Number of successful extensions: 245
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 245
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 245
length of database: 14,793,348
effective HSP length: 73
effective length of database: 12,052,636
effective search space used: 506210712
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)