BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30030 (349 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g01350.2 68415.m00052 quinolinate phosphoribosyl transferase ... 33 0.069 At2g01350.1 68415.m00053 quinolinate phosphoribosyl transferase ... 33 0.069 At5g35760.1 68418.m04284 expressed protein ; expression supporte... 27 4.5 >At2g01350.2 68415.m00052 quinolinate phosphoribosyl transferase family protein contains Pfam profile: PF01729 quinolinate phosphoribosyl transferase, C-terminal domain Length = 281 Score = 32.7 bits (71), Expect = 0.069 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +1 Query: 64 IVVLVALSLMICSGQADPKIPVKSLKKGGKVIAKGFKVLTAAGTAHEV 207 IV VAL+ MI DP + V+ ++K G + KG K +G AH++ Sbjct: 21 IVAGVALADMIFE-HVDPSLKVEWMRKDGDYVHKGLKFGKVSGNAHKI 67 >At2g01350.1 68415.m00053 quinolinate phosphoribosyl transferase family protein contains Pfam profile: PF01729 quinolinate phosphoribosyl transferase, C-terminal domain Length = 348 Score = 32.7 bits (71), Expect = 0.069 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +1 Query: 64 IVVLVALSLMICSGQADPKIPVKSLKKGGKVIAKGFKVLTAAGTAHEV 207 IV VAL+ MI DP + V+ ++K G + KG K +G AH++ Sbjct: 88 IVAGVALADMIFE-HVDPSLKVEWMRKDGDYVHKGLKFGKVSGNAHKI 134 >At5g35760.1 68418.m04284 expressed protein ; expression supported by MPSS Length = 177 Score = 26.6 bits (56), Expect = 4.5 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 152 FPPFFRLLTGIFGSACPLQIINDRATSTTMKY 57 +PP +LL GIF LQI A S M Y Sbjct: 30 YPPITKLLQGIFKYTDKLQICESLAKSGVMIY 61 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,413,306 Number of Sequences: 28952 Number of extensions: 114301 Number of successful extensions: 215 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 214 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 215 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 429398688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -