BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30024 (675 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 22 5.3 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 22 5.3 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 9.2 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 21 9.2 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 21 9.2 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 21.8 bits (44), Expect = 5.3 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -1 Query: 279 LFQIRLTGSELTGSA*ENLLTLALARAMI--CSIYHWINFIIIRVTFENVT 133 +F + +LT S + L T+ L I S+Y W FI+ ++TF VT Sbjct: 16 IFGLSPMTQKLTLSPLKVLQTVILGTTCIYLTSLYIW--FILTQMTFSGVT 64 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 21.8 bits (44), Expect = 5.3 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -1 Query: 279 LFQIRLTGSELTGSA*ENLLTLALARAMI--CSIYHWINFIIIRVTFENVT 133 +F + +LT S + L T+ L I S+Y W FI+ ++TF VT Sbjct: 16 IFGLSPMTQKLTLSPLKVLQTVILGTTCIYLTSLYIW--FILTQMTFSGVT 64 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 465 NCIISKRTNFTGECL 509 NC+ + RTNFT + L Sbjct: 251 NCLNTGRTNFTNKQL 265 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 465 NCIISKRTNFTGECL 509 NC+ + RTNFT + L Sbjct: 40 NCLNTGRTNFTNKQL 54 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 465 NCIISKRTNFTGECL 509 NC+ + RTNFT + L Sbjct: 40 NCLNTGRTNFTNKQL 54 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,316 Number of Sequences: 336 Number of extensions: 3024 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -