BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30018 (622 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 23 2.1 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 23 2.1 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 23.0 bits (47), Expect = 2.1 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 158 LQRRDW-ENPGVTQLNRLAAHPPFASWRNSEEAPPIALPNSCA 283 LQ W +NP T+LN L + + + P +LPNSCA Sbjct: 450 LQVIQWMQNP--TELNGLRDFQEWKEKCDIKGQPYCSLPNSCA 490 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 23.0 bits (47), Expect = 2.1 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 158 LQRRDW-ENPGVTQLNRLAAHPPFASWRNSEEAPPIALPNSCA 283 LQ W +NP T+LN L + + + P +LPNSCA Sbjct: 457 LQVIQWMQNP--TELNGLRDFQEWKEKCDIKGQPYCSLPNSCA 497 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,671 Number of Sequences: 336 Number of extensions: 3013 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15875032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -