BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30018 (622 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 94 9e-20 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 92 3e-19 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 5e-19 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 5e-19 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 7e-19 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 2e-17 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 85 4e-17 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 85 4e-17 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 85 4e-17 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 6e-17 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 8e-17 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 8e-17 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 84 8e-17 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 83 1e-16 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 1e-16 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 1e-16 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 83 2e-16 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 83 2e-16 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 83 2e-16 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 83 2e-16 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 83 2e-16 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 83 2e-16 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 83 2e-16 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 83 2e-16 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 83 2e-16 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 83 2e-16 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 83 2e-16 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 83 2e-16 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 83 2e-16 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 3e-16 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 82 4e-16 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 82 4e-16 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 82 4e-16 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 82 4e-16 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 82 4e-16 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 82 4e-16 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 82 4e-16 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 82 4e-16 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 82 4e-16 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 82 4e-16 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 82 4e-16 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 82 4e-16 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 82 4e-16 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 82 4e-16 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 82 4e-16 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 82 4e-16 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 82 4e-16 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 82 4e-16 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 82 4e-16 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 82 4e-16 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 82 4e-16 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 82 4e-16 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 82 4e-16 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 82 4e-16 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 82 4e-16 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 82 4e-16 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 82 4e-16 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 82 4e-16 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 82 4e-16 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 82 4e-16 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 82 4e-16 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 82 4e-16 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 82 4e-16 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 82 4e-16 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 82 4e-16 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 82 4e-16 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 82 4e-16 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 82 4e-16 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 82 4e-16 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 82 4e-16 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 82 4e-16 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 82 4e-16 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 82 4e-16 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 82 4e-16 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 82 4e-16 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 82 4e-16 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 82 4e-16 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 82 4e-16 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 82 4e-16 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 82 4e-16 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 82 4e-16 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 82 4e-16 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 82 4e-16 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 82 4e-16 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 82 4e-16 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 82 4e-16 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 82 4e-16 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 82 4e-16 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 82 4e-16 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 82 4e-16 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 82 4e-16 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 82 4e-16 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 82 4e-16 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 82 4e-16 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 82 4e-16 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 82 4e-16 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 82 4e-16 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 82 4e-16 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 93.9 bits (223), Expect = 9e-20 Identities = 48/56 (85%), Positives = 51/56 (91%), Gaps = 1/56 (1%) Frame = -2 Query: 309 YNLPFAIQAAQLL-GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 145 + PFAIQAAQLL GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLLEGRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 92.3 bits (219), Expect = 3e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 129 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 254 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 43 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 91.5 bits (217), Expect = 5e-19 Identities = 47/56 (83%), Positives = 50/56 (89%), Gaps = 1/56 (1%) Frame = -2 Query: 309 YNLPFAIQAAQLL-GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 145 + PFAIQAAQL GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 91.5 bits (217), Expect = 5e-19 Identities = 47/56 (83%), Positives = 50/56 (89%), Gaps = 1/56 (1%) Frame = -2 Query: 309 YNLPFAIQAAQLL-GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 145 + PFAIQAAQL GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 91.1 bits (216), Expect = 7e-19 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = +3 Query: 114 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAK 248 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQHIPLSPAGVIA+ Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAE 77 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 81 TDRPSQQLRSLNGEW 95 >SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 86.2 bits (204), Expect = 2e-17 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPPIALPNSCAA 286 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA +SCAA Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSHSCAA 100 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 85.0 bits (201), Expect = 4e-17 Identities = 41/63 (65%), Positives = 41/63 (65%) Frame = -3 Query: 299 HSPFRLRNCWEGRSVGPLRYYASWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 120 HSPFRLRNCWEGRSV KG GFPSHDVVKRRPVNCNTTHYR Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYR 645 Query: 119 ANW 111 ANW Sbjct: 646 ANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 85.0 bits (201), Expect = 4e-17 Identities = 41/63 (65%), Positives = 41/63 (65%) Frame = -3 Query: 299 HSPFRLRNCWEGRSVGPLRYYASWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 120 HSPFRLRNCWEGRSV KG GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYR 88 Query: 119 ANW 111 ANW Sbjct: 89 ANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 85.0 bits (201), Expect = 4e-17 Identities = 41/63 (65%), Positives = 41/63 (65%) Frame = -3 Query: 299 HSPFRLRNCWEGRSVGPLRYYASWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 120 HSPFRLRNCWEGRSV KG GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYR 88 Query: 119 ANW 111 ANW Sbjct: 89 ANW 91 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 84.6 bits (200), Expect = 6e-17 Identities = 44/61 (72%), Positives = 50/61 (81%) Frame = -2 Query: 321 NINAYNLPFAIQAAQLLGRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 142 N+ A + PF ++ GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 440 NMGASHSPFRLRNCWE-GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 497 Query: 141 L 139 L Sbjct: 498 L 498 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 84.2 bits (199), Expect = 8e-17 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 1/50 (2%) Frame = -2 Query: 285 AAQLL-GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 AAQL GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 1 AAQLWEGRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 84.2 bits (199), Expect = 8e-17 Identities = 39/47 (82%), Positives = 39/47 (82%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPPIALPNSCAA 286 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA CAA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQCAA 75 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 84.2 bits (199), Expect = 8e-17 Identities = 39/47 (82%), Positives = 39/47 (82%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPPIALPNSCAA 286 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA CAA Sbjct: 512 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQCAA 558 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 83.8 bits (198), Expect = 1e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 120 PIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV 239 P +SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG+ Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGL 116 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 123 TDRPSQQLRSLNGEW 137 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 83.4 bits (197), Expect = 1e-16 Identities = 44/62 (70%), Positives = 50/62 (80%) Frame = -2 Query: 324 QNINAYNLPFAIQAAQLLGRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 145 +N A + PF ++ GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 39 KNQGASHSPFRLRNCGE-GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 96 Query: 144 EL 139 EL Sbjct: 97 EL 98 Score = 36.3 bits (80), Expect = 0.020 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -3 Query: 341 FNANFNKILTLTICHSPFRLRNCWEGRSV 255 F F+++ HSPFRLRNC EGRSV Sbjct: 31 FAIAFHRLKNQGASHSPFRLRNCGEGRSV 59 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 83.4 bits (197), Expect = 1e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 144 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 254 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 98 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 83.4 bits (197), Expect = 1e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 144 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 254 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 93 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 83.0 bits (196), Expect = 2e-16 Identities = 43/60 (71%), Positives = 49/60 (81%) Frame = -2 Query: 318 INAYNLPFAIQAAQLLGRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 + A + PF ++ GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 175 VGASHSPFRLRNCWE-GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 HSPFRLRNCWEGRSV Sbjct: 4 HSPFRLRNCWEGRSV 18 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 227 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 HSPFRLRNCWEGRSV Sbjct: 216 HSPFRLRNCWEGRSV 230 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 895 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 Score = 28.3 bits (60), Expect = 5.3 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -3 Query: 287 RLRNCWEGRSV 255 +LRNCWEGRSV Sbjct: 888 QLRNCWEGRSV 898 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 284 LRNCWEGRSV 255 LRNCWEGRSV Sbjct: 2 LRNCWEGRSV 11 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 382 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 HSPFRLRNCWEGRSV Sbjct: 371 HSPFRLRNCWEGRSV 385 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 231 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 Score = 28.7 bits (61), Expect = 4.0 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -3 Query: 287 RLRNCWEGRSV 255 +LRNCWEGRSV Sbjct: 224 KLRNCWEGRSV 234 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 298 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 HSPFRLRNCWEGRSV Sbjct: 287 HSPFRLRNCWEGRSV 301 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 364 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 284 LRNCWEGRSV 255 LRNCWEGRSV Sbjct: 358 LRNCWEGRSV 367 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 HSPFRLRNCWEGRSV Sbjct: 4 HSPFRLRNCWEGRSV 18 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 284 LRNCWEGRSV 255 LRNCWEGRSV Sbjct: 2 LRNCWEGRSV 11 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 284 LRNCWEGRSV 255 LRNCWEGRSV Sbjct: 2 LRNCWEGRSV 11 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 HSPFRLRNCWEGRSV Sbjct: 4 HSPFRLRNCWEGRSV 18 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 HSPFRLRNCWEGRSV Sbjct: 4 HSPFRLRNCWEGRSV 18 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 38 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 HSPFRLRNCWEGRSV Sbjct: 27 HSPFRLRNCWEGRSV 41 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 274 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 287 RLRNCWEGRSV 255 RLRNCWEGRSV Sbjct: 267 RLRNCWEGRSV 277 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 258 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 Score = 28.7 bits (61), Expect = 4.0 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -3 Query: 287 RLRNCWEGRSV 255 +LRNCWEGRSV Sbjct: 251 KLRNCWEGRSV 261 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 284 LRNCWEGRSV 255 LRNCWEGRSV Sbjct: 2 LRNCWEGRSV 11 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 247 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 Score = 31.9 bits (69), Expect = 0.43 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 H RLRNCWEGRSV Sbjct: 236 HLTIRLRNCWEGRSV 250 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 272 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 HSPFRLRNCWEGRSV Sbjct: 261 HSPFRLRNCWEGRSV 275 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 125 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 284 LRNCWEGRSV 255 LRNCWEGRSV Sbjct: 119 LRNCWEGRSV 128 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 291 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 HSPFRLRNCWEGRSV Sbjct: 280 HSPFRLRNCWEGRSV 294 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 141 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 HSPFRLRNCWEGRSV Sbjct: 130 HSPFRLRNCWEGRSV 144 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 HSPFRLRNCWEGRSV Sbjct: 4 HSPFRLRNCWEGRSV 18 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 HSPFRLRNCWEGRSV Sbjct: 4 HSPFRLRNCWEGRSV 18 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 200 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 Score = 28.7 bits (61), Expect = 4.0 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -3 Query: 287 RLRNCWEGRSV 255 +LRNCWEGRSV Sbjct: 193 KLRNCWEGRSV 203 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 592 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 HSPFRLRNCWEGRSV Sbjct: 581 HSPFRLRNCWEGRSV 595 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 228 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 Score = 28.7 bits (61), Expect = 4.0 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -3 Query: 287 RLRNCWEGRSV 255 +LRNCWEGRSV Sbjct: 221 KLRNCWEGRSV 231 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 506 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 HSPFRLRNCWEGRSV Sbjct: 495 HSPFRLRNCWEGRSV 509 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 89 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 284 LRNCWEGRSV 255 LRNCWEGRSV Sbjct: 83 LRNCWEGRSV 92 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 139 GR++ ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 397 GRSVR-ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 287 RLRNCWEGRSV 255 RLRNCWEGRSV Sbjct: 390 RLRNCWEGRSV 400 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 82.2 bits (194), Expect = 3e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 129 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV 239 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV 38 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 45 TDRPSQQLRSLNGEW 59 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 70 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 72 TDRPSQQLRSLNGEW 86 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 97 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 99 TDRPSQQLRSLNGEWRLMRYFLL 121 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 79 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 81 TDRPSQQLRSLNGEW 95 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 71 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 73 TDRPSQQLRSLNGEW 87 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 97 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 99 TDRPSQQLRSLNGEW 113 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 102 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 104 TDRPSQQLRSLNGEW 118 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 73 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 75 TDRPSQQLRSLNGEW 89 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 93 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 95 TDRPSQQLRSLNGEW 109 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 105 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 107 TDRPSQQLRSLNGEW 121 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 81 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 83 TDRPSQQLRSLNGEW 97 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 70 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 72 TDRPSQQLRSLNGEW 86 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 60 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 62 TDRPSQQLRSLNGEWRLMRYFLL 84 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 85 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 87 TDRPSQQLRSLNGEW 101 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 94 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 96 TDRPSQQLRSLNGEW 110 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 88 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 90 TDRPSQQLRSLNGEW 104 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 104 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 106 TDRPSQQLRSLNGEW 120 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 92 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 94 TDRPSQQLRSLNGEW 108 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 75 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 77 TDRPSQQLRSLNGEW 91 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 251 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 253 TDRPSQQLRSLNGEW 267 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 146 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 148 TDRPSQQLRSLNGEW 162 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 84 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 86 TDRPSQQLRSLNGEWRLMRYFLL 108 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 63 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 65 TDRPSQQLRSLNGEWRLMRYFLL 87 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 51 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIV 309 TDRPSQQLRSLNGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 82 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 84 TDRPSQQLRSLNGEW 98 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 416 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 418 TDRPSQQLRSLNGEW 432 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIV 309 TDRPSQQLRSLNGEW+++ Sbjct: 66 TDRPSQQLRSLNGEWRLM 83 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 142 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 144 TDRPSQQLRSLNGEW 158 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 118 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 120 TDRPSQQLRSLNGEW 134 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 74 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 76 TDRPSQQLRSLNGEW 90 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 43 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 45 TDRPSQQLRSLNGEW 59 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 53 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIV 309 TDRPSQQLRSLNGEW+++ Sbjct: 55 TDRPSQQLRSLNGEWRLM 72 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 73 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 75 TDRPSQQLRSLNGEW 89 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 138 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 140 TDRPSQQLRSLNGEW 154 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 80 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 82 TDRPSQQLRSLNGEW 96 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 375 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 377 TDRPSQQLRSLNGEW 391 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 115 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 117 TDRPSQQLRSLNGEW 131 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 85 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 87 TDRPSQQLRSLNGEW 101 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 51 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIV 309 TDRPSQQLRSLNGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 94 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 96 TDRPSQQLRSLNGEW 110 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 78 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 80 TDRPSQQLRSLNGEW 94 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 169 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 171 TDRPSQQLRSLNGEW 185 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 98 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 100 TDRPSQQLRSLNGEW 114 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 74 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 76 TDRPSQQLRSLNGEW 90 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 178 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 180 TDRPSQQLRSLNGEW 194 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 868 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNILLKFAL 339 TDRPSQQLRSLNGEW+++ +L L Sbjct: 870 TDRPSQQLRSLNGEWRLMRYFLLTHLIL 897 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 51 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIV 309 TDRPSQQLRSLNGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 95 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 97 TDRPSQQLRSLNGEW 111 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 69 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 71 TDRPSQQLRSLNGEW 85 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 108 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 110 TDRPSQQLRSLNGEW 124 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 91 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 93 TDRPSQQLRSLNGEW 107 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 104 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 106 TDRPSQQLRSLNGEW 120 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 291 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 293 TDRPSQQLRSLNGEW 307 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 149 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 151 TDRPSQQLRSLNGEWRLMRYFLL 173 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 85 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 87 TDRPSQQLRSLNGEW 101 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 71 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 73 TDRPSQQLRSLNGEW 87 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 72 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 74 TDRPSQQLRSLNGEW 88 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 136 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 138 TDRPSQQLRSLNGEW 152 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 149 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 151 TDRPSQQLRSLNGEW 165 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 74 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 76 TDRPSQQLRSLNGEWRLMRYFLL 98 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 55 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIV 309 TDRPSQQLRSLNGEW+++ Sbjct: 57 TDRPSQQLRSLNGEWRLM 74 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 93 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 95 TDRPSQQLRSLNGEW 109 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 72 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 74 TDRPSQQLRSLNGEW 88 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 69 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 71 TDRPSQQLRSLNGEW 85 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 46 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 48 TDRPSQQLRSLNGEWRLMRYFLL 70 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 54 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIV 309 TDRPSQQLRSLNGEW+++ Sbjct: 56 TDRPSQQLRSLNGEWRLM 73 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 431 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 433 TDRPSQQLRSLNGEW 447 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 80 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 82 TDRPSQQLRSLNGEW 96 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 89 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 91 TDRPSQQLRSLNGEW 105 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 71 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 73 TDRPSQQLRSLNGEW 87 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 154 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 156 TDRPSQQLRSLNGEW 170 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 90 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 92 TDRPSQQLRSLNGEW 106 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 100 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 102 TDRPSQQLRSLNGEW 116 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 103 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 105 TDRPSQQLRSLNGEW 119 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 449 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 451 TDRPSQQLRSLNGEW 465 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 146 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 148 TDRPSQQLRSLNGEW 162 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 102 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 104 TDRPSQQLRSLNGEW 118 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 91 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 93 TDRPSQQLRSLNGEW 107 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 81 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 83 TDRPSQQLRSLNGEW 97 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 196 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 198 TDRPSQQLRSLNGEW 212 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 100 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 102 TDRPSQQLRSLNGEW 116 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 87 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 89 TDRPSQQLRSLNGEW 103 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 123 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 125 TDRPSQQLRSLNGEWRLMRYFLL 147 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 72 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIV 309 TDRPSQQLRSLNGEW+++ Sbjct: 74 TDRPSQQLRSLNGEWRLM 91 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 98 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 100 TDRPSQQLRSLNGEW 114 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 77 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 79 TDRPSQQLRSLNGEW 93 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 220 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 222 TDRPSQQLRSLNGEW 236 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 69 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 71 TDRPSQQLRSLNGEW 85 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 75 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 77 TDRPSQQLRSLNGEW 91 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 89 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 91 TDRPSQQLRSLNGEW 105 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 86 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 88 TDRPSQQLRSLNGEW 102 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 69 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 71 TDRPSQQLRSLNGEW 85 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 70 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 72 TDRPSQQLRSLNGEW 86 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 84 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 86 TDRPSQQLRSLNGEW 100 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 74 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 76 TDRPSQQLRSLNGEW 90 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 167 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIV 309 TDRPSQQLRSLNGEW+++ Sbjct: 169 TDRPSQQLRSLNGEWRLM 186 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 76 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 78 TDRPSQQLRSLNGEW 92 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 119 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 121 TDRPSQQLRSLNGEW 135 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 57 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 59 TDRPSQQLRSLNGEWRLMRYFLL 81 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 188 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 190 TDRPSQQLRSLNGEWRLMRYFLL 212 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 375 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 377 TDRPSQQLRSLNGEW 391 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 92 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 94 TDRPSQQLRSLNGEWRLMRYFLL 116 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 56 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIV 309 TDRPSQQLRSLNGEW+++ Sbjct: 58 TDRPSQQLRSLNGEWRLM 75 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 144 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 146 TDRPSQQLRSLNGEW 160 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 121 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 123 TDRPSQQLRSLNGEW 137 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 71 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 73 TDRPSQQLRSLNGEW 87 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 95 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 97 TDRPSQQLRSLNGEWRLMRYFLL 119 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 294 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 329 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 331 TDRPSQQLRSLNGEW 345 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 92 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 94 TDRPSQQLRSLNGEW 108 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 93 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 95 TDRPSQQLRSLNGEW 109 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 51 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIV 309 TDRPSQQLRSLNGEW+++ Sbjct: 53 TDRPSQQLRSLNGEWRLM 70 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 71 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 73 TDRPSQQLRSLNGEW 87 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 411 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 446 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 448 TDRPSQQLRSLNGEW 462 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 95 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 130 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 132 TDRPSQQLRSLNGEW 146 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 86 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 88 TDRPSQQLRSLNGEW 102 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 78 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 80 TDRPSQQLRSLNGEW 94 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 128 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 130 TDRPSQQLRSLNGEW 144 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 78 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 80 TDRPSQQLRSLNGEW 94 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 211 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 246 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 248 TDRPSQQLRSLNGEW 262 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 78 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 80 TDRPSQQLRSLNGEW 94 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 248 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 250 TDRPSQQLRSLNGEWRLMRYFLL 272 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 68 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIV 309 TDRPSQQLRSLNGEW+++ Sbjct: 70 TDRPSQQLRSLNGEWRLM 87 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 83 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 85 TDRPSQQLRSLNGEWRLMRYFLL 107 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 73 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 75 TDRPSQQLRSLNGEW 89 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 78 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 80 TDRPSQQLRSLNGEW 94 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 147 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 182 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 184 TDRPSQQLRSLNGEW 198 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 80 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 82 TDRPSQQLRSLNGEW 96 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 70 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 72 TDRPSQQLRSLNGEW 86 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 90 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 92 TDRPSQQLRSLNGEW 106 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 75 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 77 TDRPSQQLRSLNGEWRLMRYFLL 99 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 110 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 112 TDRPSQQLRSLNGEWRLMRYFLL 134 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 195 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 230 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 232 TDRPSQQLRSLNGEW 246 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 88 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 90 TDRPSQQLRSLNGEW 104 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 67 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 69 TDRPSQQLRSLNGEW 83 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 121 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 123 TDRPSQQLRSLNGEW 137 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 57 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 59 TDRPSQQLRSLNGEWRLMRYFLL 81 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 84 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 86 TDRPSQQLRSLNGEW 100 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 222 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 224 TDRPSQQLRSLNGEW 238 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 92 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 94 TDRPSQQLRSLNGEW 108 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 102 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 104 TDRPSQQLRSLNGEW 118 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 85 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 87 TDRPSQQLRSLNGEW 101 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 92 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 94 TDRPSQQLRSLNGEWRLMRYFLL 116 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 135 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNILLK 330 TDRPSQQLRSLNGEW+++ + K Sbjct: 137 TDRPSQQLRSLNGEWRLMRRQVRAK 161 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 111 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 113 TDRPSQQLRSLNGEW 127 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 131 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 133 TDRPSQQLRSLNGEW 147 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 108 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 110 TDRPSQQLRSLNGEWRLMRYFLL 132 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 75 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 77 TDRPSQQLRSLNGEW 91 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 84 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 86 TDRPSQQLRSLNGEW 100 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 663 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 698 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 700 TDRPSQQLRSLNGEW 714 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 83 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 85 TDRPSQQLRSLNGEW 99 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 72 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 74 TDRPSQQLRSLNGEW 88 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 63 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 65 TDRPSQQLRSLNGEWRLMRYFLL 87 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 181 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIV 309 TDRPSQQLRSLNGEW+++ Sbjct: 183 TDRPSQQLRSLNGEWRLM 200 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 73 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 75 TDRPSQQLRSLNGEW 89 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 94 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 96 TDRPSQQLRSLNGEWRLMRYFLL 118 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 123 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 125 TDRPSQQLRSLNGEWRLMRYFLL 147 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 71 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 73 TDRPSQQLRSLNGEW 87 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 135 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 137 TDRPSQQLRSLNGEWRLMRYFLL 159 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 78 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 80 TDRPSQQLRSLNGEW 94 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 1190 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 1225 Score = 45.6 bits (103), Expect = 3e-05 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -2 Query: 270 GRAIGGASSLLRQLAKGGCAARRLSW 193 GR++ ASSLLRQLAKGGCAARRLSW Sbjct: 415 GRSVR-ASSLLRQLAKGGCAARRLSW 439 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 299 HSPFRLRNCWEGRSV 255 HSPFRLRNCWEGRSV Sbjct: 404 HSPFRLRNCWEGRSV 418 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIV 309 TDRPSQQLRSLNGEW+++ Sbjct: 1227 TDRPSQQLRSLNGEWRLM 1244 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 77 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 79 TDRPSQQLRSLNGEW 93 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 67 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 69 TDRPSQQLRSLNGEWRLMRYFLL 91 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 160 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIVSVNIL 324 TDRPSQQLRSLNGEW+++ +L Sbjct: 162 TDRPSQQLRSLNGEWRLMRYFLL 184 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 66 TDRPSQQLRSLNGEW 80 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 91 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 93 TDRPSQQLRSLNGEW 107 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 77 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 112 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIV 309 TDRPSQQLRSLNGEW+++ Sbjct: 114 TDRPSQQLRSLNGEWRLM 131 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 85 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 87 TDRPSQQLRSLNGEW 101 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 161 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 163 TDRPSQQLRSLNGEW 177 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 168 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 203 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 205 TDRPSQQLRSLNGEW 219 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 66 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEWQIV 309 TDRPSQQLRSLNGEW+++ Sbjct: 68 TDRPSQQLRSLNGEWRLM 85 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 115 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 117 TDRPSQQLRSLNGEW 131 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 65 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLR+LNGEW Sbjct: 67 TDRPSQQLRTLNGEW 81 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 81.8 bits (193), Expect = 4e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 253 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 80 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 TDRPSQQLRSLNGEW 300 TDRPSQQLRSLNGEW Sbjct: 82 TDRPSQQLRSLNGEW 96 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,553,588 Number of Sequences: 59808 Number of extensions: 406503 Number of successful extensions: 9366 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9316 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -