BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30013 (335 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41266| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.025 SB_6398| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.10 SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.18 SB_29436| Best HMM Match : PAN (HMM E-Value=0.021) 31 0.23 SB_19120| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.23 SB_49251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.71 SB_6472| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.71 SB_33701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) 29 1.2 SB_39786| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.2 SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.2 SB_59677| Best HMM Match : RVT_1 (HMM E-Value=2.1e-28) 27 2.9 SB_47913| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_30707| Best HMM Match : ARID (HMM E-Value=4e-35) 27 3.8 SB_27822| Best HMM Match : DUF1165 (HMM E-Value=7.6) 27 3.8 SB_12074| Best HMM Match : APC8 (HMM E-Value=0.7) 27 3.8 SB_58058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_39603| Best HMM Match : HATPase_c (HMM E-Value=0.0009) 27 5.0 SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.6 SB_40532| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.6 SB_11269| Best HMM Match : Extensin_2 (HMM E-Value=0.14) 26 6.6 SB_33000| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.6 SB_26152| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.6 SB_23765| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.6 SB_15490| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.6 SB_58135| Best HMM Match : bZIP_1 (HMM E-Value=1.4e-09) 26 8.7 SB_39545| Best HMM Match : TolA (HMM E-Value=0.12) 26 8.7 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 26 8.7 >SB_41266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 660 Score = 34.3 bits (75), Expect = 0.025 Identities = 20/59 (33%), Positives = 25/59 (42%) Frame = -3 Query: 288 RRAESQQIAARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR*HRSP 112 R Q P STT E +SSTD EP + + + +RD R NR R P Sbjct: 180 RHPRHSQQTETPETQSTTETSETQSSTDTREPVNNRDTRETVNNRDTRDTVNNRDTRDP 238 Score = 27.9 bits (59), Expect = 2.2 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Frame = -3 Query: 297 ITWRRAESQQIAARPALPST--TPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR* 124 IT E+Q P ST T E +S+TD +P + + + +RD R N Sbjct: 71 ITTETPETQSTTDTPETQSTITTETPETQSTTDTRDPVNNRDTRDPINNRDTRDPVNNTD 130 Query: 123 HRSP 112 R P Sbjct: 131 TRDP 134 >SB_6398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 32.3 bits (70), Expect = 0.10 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = -3 Query: 279 ESQQIAARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR*HRSP 112 E+Q A P STT E +S+TD + + + + +RD R NR R P Sbjct: 100 ETQSTTATPETQSTTQTPETQSTTDTRDTVNNRDTRDPVNNRDTRDAVNNRDTRDP 155 Score = 27.9 bits (59), Expect = 2.2 Identities = 15/56 (26%), Positives = 25/56 (44%) Frame = -3 Query: 279 ESQQIAARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR*HRSP 112 E+Q P STT ++ ++ D +P + + + +RD R NR R P Sbjct: 109 ETQSTTQTPETQSTTDTRDTVNNRDTRDPVNNRDTRDAVNNRDTRDPVNNRDTRDP 164 Score = 26.2 bits (55), Expect = 6.6 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -3 Query: 255 PALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR 127 P STT E +S+T E + T+ + +RD R NR Sbjct: 99 PETQSTTATPETQSTTQTPETQSTTDTRDTVNNRDTRDPVNNR 141 >SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3176 Score = 31.5 bits (68), Expect = 0.18 Identities = 22/50 (44%), Positives = 29/50 (58%) Frame = -3 Query: 243 STTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR*HRSPRSKWAS 94 S QER++ D + PRH EL PD+R D RV ++ R R P SK A+ Sbjct: 1453 SRVESQERQTMRD-TRPRHPDELRPDIR-HDIRVAQERREGR-PDSKDAT 1499 >SB_29436| Best HMM Match : PAN (HMM E-Value=0.021) Length = 419 Score = 31.1 bits (67), Expect = 0.23 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = -3 Query: 279 ESQQIAARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR*HRSP 112 E+Q P STT E +S+TD +P + + + + D R NR R P Sbjct: 156 ETQSPTQTPETQSTTTTPETQSTTDTRDPVNNNDTRDPVNNNDTRDPVNNRDTRDP 211 Score = 26.6 bits (56), Expect = 5.0 Identities = 14/56 (25%), Positives = 24/56 (42%) Frame = -3 Query: 279 ESQQIAARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR*HRSP 112 E+Q P STT ++ ++ D +P + + + +RD R N R P Sbjct: 165 ETQSTTTTPETQSTTDTRDPVNNNDTRDPVNNNDTRDPVNNRDTRDPVNNTDTRDP 220 >SB_19120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 31.1 bits (67), Expect = 0.23 Identities = 18/61 (29%), Positives = 28/61 (45%) Frame = -3 Query: 294 TWRRAESQQIAARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR*HRS 115 ++R +Q P STT E +S+T+ E + T+ + +RD R NR R Sbjct: 796 SYRLKFTQSTTETPETQSTTETPETQSTTETPENQSTTDTRDPVNNRDTRDPVNNRDTRD 855 Query: 114 P 112 P Sbjct: 856 P 856 >SB_49251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1560 Score = 29.5 bits (63), Expect = 0.71 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 128 DSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDS 24 DS ++DP G+RR++ F E R V L+ D+ Sbjct: 101 DSPPIKDPPGVRRKIEEFTIEQRAVNKRRLDLLDT 135 >SB_6472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 29.5 bits (63), Expect = 0.71 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = -3 Query: 246 PSTTPRQERKSSTDYSE-PRHRTELYPD-LRSRDARVKKKNR 127 P+T PR +R+S T S+ RH + L PD + R ++ NR Sbjct: 8 PNTIPRSDRRSRTGISQRHRHTSSLTPDTMAGTHLREQQSNR 49 >SB_33701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 974 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Frame = -3 Query: 261 ARPALPSTTPRQERKSSTDYSEPRHRTELYPDL----RSRDARVKK 136 A+PA+P+T +Q+++ P++ + PD+ R+R RV K Sbjct: 923 AKPAMPTTHKQQQQEKQPSEKAPKNTAQDVPDVPAEQRTRSGRVVK 968 >SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) Length = 765 Score = 28.7 bits (61), Expect = 1.2 Identities = 25/78 (32%), Positives = 38/78 (48%) Frame = -3 Query: 288 RRAESQQIAARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR*HRSPR 109 RR+ S Q + P S +PR ++ + S +HR+ RSR R K+ RSPR Sbjct: 246 RRSRSPQKSRSPQR-SRSPRSSKRYRSSRSHRKHRSHS----RSRSPRSKRS----RSPR 296 Query: 108 SKWASTSRLAF*MRNATS 55 + S SR R+++S Sbjct: 297 KRRRSKSRSPRRYRDSSS 314 Score = 27.5 bits (58), Expect = 2.9 Identities = 26/81 (32%), Positives = 36/81 (44%) Frame = -3 Query: 246 PSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR*HRSPRSKWASTSRLAF*MR 67 PST R+ R S S ++ + RSR +R KK+R R RS+ SR R Sbjct: 205 PSTDKRKSRSRSRSRSRSHRKSRKRSESRSR-SRSPKKSRSAR--RSRSPQKSRSPQRSR 261 Query: 66 NATSKVTLFRASRLSGLHSEH 4 + S +R+SR H H Sbjct: 262 SPRSS-KRYRSSRSHRKHRSH 281 >SB_39786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 294 Score = 27.9 bits (59), Expect = 2.2 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Frame = -3 Query: 297 ITWRRAESQQIAARPALPST--TPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR* 124 IT E+Q P ST T E +S+TD +P + + + +RD R N Sbjct: 71 ITTETPETQSTTDTPETQSTITTETPETQSTTDTRDPVNNRDTRDPINNRDTRDPVNNTD 130 Query: 123 HRSP 112 R P Sbjct: 131 TRDP 134 >SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 27.9 bits (59), Expect = 2.2 Identities = 16/53 (30%), Positives = 23/53 (43%) Frame = -3 Query: 297 ITWRRAESQQIAARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVK 139 + W+ AE RPA TT + R +S R +E P R AR++ Sbjct: 109 LKWK-AEGGAFTERPATTDTTTQTTRATSQTIPTTRATSEAMPKTRGYRARIR 160 >SB_59677| Best HMM Match : RVT_1 (HMM E-Value=2.1e-28) Length = 1159 Score = 27.5 bits (58), Expect = 2.9 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Frame = -3 Query: 261 ARPALPSTTPRQERKSSTDYSEPRHRTELYPDL----RSRDARVKK 136 A+PA+P+T +Q+++ P + + PD+ R+R RV K Sbjct: 1109 AKPAMPTTHKQQQQEKQPSDKAPENTAQDVPDVPAEQRTRSGRVVK 1154 >SB_47913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 27.1 bits (57), Expect = 3.8 Identities = 13/47 (27%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -3 Query: 261 ARPALPSTTPRQERKSSTDYSEPRHRTELYPDL--RSRDARVKKKNR 127 A+PA+P+T +Q+++ P + + PD+ R KK+ R Sbjct: 172 AKPAMPTTHKQQQQEKQPSEKAPENTAQGVPDVPAEQRTRSAKKRYR 218 >SB_30707| Best HMM Match : ARID (HMM E-Value=4e-35) Length = 1338 Score = 27.1 bits (57), Expect = 3.8 Identities = 18/61 (29%), Positives = 27/61 (44%) Frame = -3 Query: 303 GRITWRRAESQQIAARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR* 124 G + + E + +P ++ PR + KS S+ +HR R R R KKK R Sbjct: 823 GSTSSSKDECESTKEKPEKHTSRPRHDSKSDKKNSDDKHR-------RHRRRREKKKQRH 875 Query: 123 H 121 H Sbjct: 876 H 876 >SB_27822| Best HMM Match : DUF1165 (HMM E-Value=7.6) Length = 167 Score = 27.1 bits (57), Expect = 3.8 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -3 Query: 273 QQIAARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDAR 145 +Q+ P + TP + SS+ SEP H PDL A+ Sbjct: 25 RQLGETPYIYDRTPSRASSSSSSRSEPGHEYPDEPDLAESRAQ 67 >SB_12074| Best HMM Match : APC8 (HMM E-Value=0.7) Length = 326 Score = 27.1 bits (57), Expect = 3.8 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -3 Query: 273 QQIAARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDAR 145 +Q+ P + TP + SS+ SEP H PDL A+ Sbjct: 184 RQLGETPYIYDRTPSRASSSSSSRSEPGHEYPDEPDLAESRAQ 226 >SB_58058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 26.6 bits (56), Expect = 5.0 Identities = 13/51 (25%), Positives = 28/51 (54%) Frame = -3 Query: 261 ARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR*HRSPR 109 A+PA+P+T +Q+++ +P + P++ ++D V + + RS R Sbjct: 318 AKPAMPTTHKQQQQQQQQQEKQPSKKA---PEITAQDGPVHQPEQRTRSGR 365 >SB_39603| Best HMM Match : HATPase_c (HMM E-Value=0.0009) Length = 888 Score = 26.6 bits (56), Expect = 5.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 257 DLLYRAQHPARNGSRLQTIPSPD 189 D +R HP + S +QT+PS D Sbjct: 175 DSAHRTDHPTQTESTVQTLPSTD 197 >SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3293 Score = 26.2 bits (55), Expect = 6.6 Identities = 10/42 (23%), Positives = 23/42 (54%) Frame = -3 Query: 261 ARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKK 136 A+P +P+T +Q+++ P + + P + +ARV++ Sbjct: 3250 AKPVMPTTHKQQQQEKQPSEKAPENAARMSPMSQRSNARVQE 3291 >SB_40532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 26.2 bits (55), Expect = 6.6 Identities = 14/54 (25%), Positives = 21/54 (38%) Frame = -3 Query: 300 RITWRRAESQQIAARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVK 139 RIT + AA+P S + + D PRH+T D R + + Sbjct: 14 RITKTSKPQDKQAAKPRQASRKTKTSKPQDRDKQAPRHKTSKPQDTRQASRKTE 67 >SB_11269| Best HMM Match : Extensin_2 (HMM E-Value=0.14) Length = 817 Score = 26.2 bits (55), Expect = 6.6 Identities = 15/52 (28%), Positives = 20/52 (38%) Frame = -3 Query: 261 ARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR*HRSPRS 106 A PA+P P Y E + YP L ++ N RSPR+ Sbjct: 202 APPAIPPLPPSPSSPKQKRYEELLEKPGAYPTLPRKEETPHPVNTPARSPRN 253 >SB_33000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 26.2 bits (55), Expect = 6.6 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = -3 Query: 261 ARPALPSTTPRQERKSSTDYSEPRHRTELYPDL 163 A+PA+P+T +Q+++ P + + PD+ Sbjct: 736 AKPAMPTTNKQQQQEKQPSEKAPENTAQDVPDV 768 >SB_26152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1380 Score = 26.2 bits (55), Expect = 6.6 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -3 Query: 288 RRAESQQIAARPALPSTTPRQERKSSTDYSEPRHR 184 R+ + + RP+ PSTT R ++T HR Sbjct: 1098 RKGHACGVMGRPSTPSTTKRSSYATATQKGNSTHR 1132 >SB_23765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 26.2 bits (55), Expect = 6.6 Identities = 16/59 (27%), Positives = 30/59 (50%) Frame = -3 Query: 261 ARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR*HRSPRSKWASTSR 85 A+PA+P+TT R+++ R + P + +ARV++ + RSK ++ R Sbjct: 348 AKPAMPTTTSSSSRRNNLQRKPLRMLPRMSPMSQRSNARVQEGKA--ANSRSKVGASKR 404 >SB_15490| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 26.2 bits (55), Expect = 6.6 Identities = 23/80 (28%), Positives = 36/80 (45%) Frame = -3 Query: 267 IAARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR*HRSPRSKWASTS 88 +AA P P +TPRQ+R++ + ++ PR R R KK+ R S R ++ Sbjct: 102 LAASP--PVSTPRQQRRTPSSFT-PRSSIS-----RRRSDTPKKRRRISVSRRRAGSALG 153 Query: 87 RLAF*MRNATSKVTLFRASR 28 RL + + L A R Sbjct: 154 RLTTKKKTPPRRTNLLEAFR 173 >SB_58135| Best HMM Match : bZIP_1 (HMM E-Value=1.4e-09) Length = 275 Score = 25.8 bits (54), Expect = 8.7 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 13 VEPRESGGSKQCDFTSRVSHSKRETRRRSPFG 108 +EP + S C+F+SR+ T+RR PFG Sbjct: 1 MEPAATPPSSSCEFSSRLL-----TKRRCPFG 27 >SB_39545| Best HMM Match : TolA (HMM E-Value=0.12) Length = 1189 Score = 25.8 bits (54), Expect = 8.7 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 1/70 (1%) Frame = -3 Query: 288 RRAESQQIAARPALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR*HRSPR 109 R+ + + RP++PSTT R ++T R E + + + V+ + R + S + Sbjct: 1051 RKGHACGVMGRPSMPSTTKRSSYATATQKGNSTGR-ENHRESYQTNGMVQDEARSNNSYK 1109 Query: 108 SKWA-STSRL 82 S+ + S+SRL Sbjct: 1110 SRDSKSSSRL 1119 >SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) Length = 996 Score = 25.8 bits (54), Expect = 8.7 Identities = 12/50 (24%), Positives = 27/50 (54%) Frame = -1 Query: 296 SPGAGLSLNRSQHDLLYRAQHPARNGSRLQTIPSPDIELSYIRTFGAVMH 147 +P A ++ ++ L+ +A HP +NG + + +P + S + A++H Sbjct: 183 APNAEVTFPKNNSTLVLKALHPIKNGEVYRMV-TPLLRPSILGPTSAIVH 231 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,175,401 Number of Sequences: 59808 Number of extensions: 198019 Number of successful extensions: 855 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 765 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 836 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 473307974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -