BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30011 (413 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.87 SB_10841| Best HMM Match : C1_1 (HMM E-Value=3.2) 27 8.1 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 29.9 bits (64), Expect = 0.87 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 Query: 147 CN*IVMSCKPMFGKMKSWRLVALXEGRSNGNPI 49 C+ V+ CKP G W+ + + S G+PI Sbjct: 40 CDDYVIECKPRAGSNDQWKFIRITHMDSGGHPI 72 >SB_10841| Best HMM Match : C1_1 (HMM E-Value=3.2) Length = 544 Score = 26.6 bits (56), Expect = 8.1 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 100 LHFTKHGLAGHHYSIAKRHRT*PTEPSHVCL 192 +H+ +H +A HH A R PS VC+ Sbjct: 482 VHYGRHSMACHHLLCALRDAYNGVSPSTVCI 512 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,102,923 Number of Sequences: 59808 Number of extensions: 210565 Number of successful extensions: 330 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 314 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 330 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 764823134 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -