BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30011 (413 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U71363-1|AAB16809.1| 431|Homo sapiens zinc finger protein zfp6 ... 29 8.1 >U71363-1|AAB16809.1| 431|Homo sapiens zinc finger protein zfp6 protein. Length = 431 Score = 28.7 bits (61), Expect = 8.1 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Frame = +1 Query: 97 GLHFTKHGLAGHHYS----IAKRHRT*PTEPSHVCLKCRKIKMKYAS 225 G H++ HG + H+S +++ R P E +VC +C K KY S Sbjct: 160 GAHYS-HGDSMKHFSTKHILSQHQRLLPREECYVCCECGKSFSKYVS 205 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,474,557 Number of Sequences: 237096 Number of extensions: 1028575 Number of successful extensions: 2224 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2224 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3087725076 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -