BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30010 (756 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45992| Best HMM Match : HCO3_cotransp (HMM E-Value=0) 29 4.1 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 29 4.1 >SB_45992| Best HMM Match : HCO3_cotransp (HMM E-Value=0) Length = 890 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +1 Query: 607 PNWRLDTFVFLFIYQSCPHPGRNWLLSSQG*TILYFKKNILHTTN 741 P + LD FV F+ C G W+ ++ T+ + ++H+TN Sbjct: 715 PGYNLDLFVVGFLMGMCSVLGLPWMCATPVHTVSHLHALMVHSTN 759 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 535 IGICVPSKSYIPSWQPCHHNPWTP 464 +GI V +S+ PSW C + P++P Sbjct: 183 VGISVRCRSFAPSWAVCTNPPFSP 206 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,146,730 Number of Sequences: 59808 Number of extensions: 433377 Number of successful extensions: 1089 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1008 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1082 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -