BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30010 (756 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79754-10|CAB02099.1| 181|Caenorhabditis elegans Hypothetical p... 74 1e-13 AF101316-3|AAC69232.2| 508|Caenorhabditis elegans Hypothetical ... 29 2.7 Z81054-12|CAB61006.1| 1781|Caenorhabditis elegans Hypothetical p... 29 4.7 Z81032-6|CAB60991.1| 1781|Caenorhabditis elegans Hypothetical pr... 29 4.7 AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 prote... 29 4.7 AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 prote... 29 4.7 AF038576-1|AAC38973.1| 1781|Caenorhabditis elegans CED-5 protein. 29 4.7 Z48544-2|CAA88437.1| 766|Caenorhabditis elegans Hypothetical pr... 28 6.2 U40958-3|ABQ13075.1| 219|Caenorhabditis elegans Hypothetical pr... 28 6.2 Z82070-4|CAB04913.2| 227|Caenorhabditis elegans Hypothetical pr... 28 8.2 >Z79754-10|CAB02099.1| 181|Caenorhabditis elegans Hypothetical protein F25H2.11 protein. Length = 181 Score = 73.7 bits (173), Expect = 1e-13 Identities = 35/65 (53%), Positives = 47/65 (72%), Gaps = 2/65 (3%) Frame = +2 Query: 62 MKIYKDIITGDEMFSDTYKMKLVDEVIYEVTGRLVTRAQGDIQIEGFNPSAEEA--DEGT 235 M IYKDI T DE+ SD++ MKLVD+++YE G+ V R +G+I + G NPSAEE D+G+ Sbjct: 1 MLIYKDIFTDDELSSDSFPMKLVDDLVYEFKGKHVVRKEGEIVLAGSNPSAEEGAEDDGS 60 Query: 236 DSAVE 250 D VE Sbjct: 61 DEHVE 65 Score = 56.8 bits (131), Expect = 2e-08 Identities = 33/92 (35%), Positives = 52/92 (56%), Gaps = 7/92 (7%) Frame = +1 Query: 256 VDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQ--VEVFKTNMNKVMKDI 429 +DIVLNH+LVE + D + Y+K +MK ++ +E+ D+ V+ FK + + + Sbjct: 68 IDIVLNHKLVEMNCYEDASMFKAYIKKFMKNVIDHMEKNNRDKADVDAFKKKIQGWVVSL 127 Query: 430 LG--RFKELQFFTGESM---DCDGMVAMMEYK 510 L RFK L FF GE +G VA++EY+ Sbjct: 128 LAKDRFKNLAFFIGERAAEGAENGQVAIIEYR 159 >AF101316-3|AAC69232.2| 508|Caenorhabditis elegans Hypothetical protein F52F10.2 protein. Length = 508 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 414 FVHVCFKYFNLVRRLLFQFCY*FFHI 337 F+++C +Y RR L FCY F I Sbjct: 137 FIYLCIEYLPTGRRYLMMFCYILFDI 162 >Z81054-12|CAB61006.1| 1781|Caenorhabditis elegans Hypothetical protein C02F4.1 protein. Length = 1781 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 307 KKSYTLYLKDYMKKLVAKLEEK 372 +K+Y YL+++MK LVA + EK Sbjct: 754 EKTYKQYLREFMKSLVALMSEK 775 >Z81032-6|CAB60991.1| 1781|Caenorhabditis elegans Hypothetical protein C02F4.1 protein. Length = 1781 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 307 KKSYTLYLKDYMKKLVAKLEEK 372 +K+Y YL+++MK LVA + EK Sbjct: 754 EKTYKQYLREFMKSLVALMSEK 775 >AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 protein protein. Length = 18519 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +1 Query: 289 TYAFG--DKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQ 453 T+ FG D++ Y++ +KD KKL + E+ + TN K + G+ K L+ Sbjct: 11103 TFNFGQKDQEQYSMVMKDVSKKLARQNAEEIQSGKLIPTTNEEKTGLALTGKNKNLK 11159 >AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 protein protein. Length = 18534 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +1 Query: 289 TYAFG--DKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQ 453 T+ FG D++ Y++ +KD KKL + E+ + TN K + G+ K L+ Sbjct: 11103 TFNFGQKDQEQYSMVMKDVSKKLARQNAEEIQSGKLIPTTNEEKTGLALTGKNKNLK 11159 >AF038576-1|AAC38973.1| 1781|Caenorhabditis elegans CED-5 protein. Length = 1781 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 307 KKSYTLYLKDYMKKLVAKLEEK 372 +K+Y YL+++MK LVA + EK Sbjct: 754 EKTYKQYLREFMKSLVALMSEK 775 >Z48544-2|CAA88437.1| 766|Caenorhabditis elegans Hypothetical protein ZK945.3 protein. Length = 766 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +1 Query: 304 DKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKE 447 +KK+ L L +K + K+EEKA K+ ++K +KD L R K+ Sbjct: 22 EKKAKGLKLNKVDRKRIVKIEEKA-----ALKSKVDKAVKDELERLKK 64 >U40958-3|ABQ13075.1| 219|Caenorhabditis elegans Hypothetical protein F09F9.5 protein. Length = 219 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -1 Query: 366 FQFCY*FFHIVFEVQCVGFLVTEGVCF 286 +Q C+ F H+ +GF GVCF Sbjct: 53 YQTCFGFMHVKIATCSIGFFALLGVCF 79 >Z82070-4|CAB04913.2| 227|Caenorhabditis elegans Hypothetical protein W04E12.4 protein. Length = 227 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = +2 Query: 116 KMKLVDEVIYEVTGRLVTRAQGDIQIEGFNPSAEEADEGTDSAVESEL 259 K+++ DE+I + + + D ++ S E+D+GTDS +ESE+ Sbjct: 130 KIEMEDEIIGQW---VADDSDNDENVKNSPTSEPESDDGTDSDLESEI 174 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,881,220 Number of Sequences: 27780 Number of extensions: 345713 Number of successful extensions: 983 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 983 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1798543458 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -