BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30010 (756 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16640.1 68416.m02127 translationally controlled tumor family... 56 3e-08 At3g05540.1 68416.m00607 translationally controlled tumor family... 55 4e-08 At4g29060.1 68417.m04157 elongation factor Ts family protein sim... 33 0.27 At2g17050.1 68415.m01968 disease resistance protein (TIR-NBS-LRR... 31 0.83 At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to ... 29 2.5 At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to ... 29 2.5 At1g63910.1 68414.m07236 myb family transcription factor (MYB103... 29 3.3 At1g43760.1 68414.m05034 hypothetical protein 29 3.3 At1g80960.3 68414.m09501 F-box protein-related contains weak hit... 28 7.7 At1g80960.2 68414.m09500 F-box protein-related contains weak hit... 28 7.7 At1g80960.1 68414.m09499 F-box protein-related contains weak hit... 28 7.7 At1g08710.1 68414.m00967 F-box family protein similar to ESTs gb... 28 7.7 >At3g16640.1 68416.m02127 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 168 Score = 56.0 bits (129), Expect = 3e-08 Identities = 28/66 (42%), Positives = 44/66 (66%), Gaps = 3/66 (4%) Frame = +2 Query: 62 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVTRAQGDIQIEGFNPSAEEA--DEG 232 M +Y+D++TGDE+ SD++ K ++ +++EV G+ VT D+ I G NPSAEE DEG Sbjct: 1 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVTVGAVDVNI-GANPSAEEGGEDEG 59 Query: 233 TDSAVE 250 D + + Sbjct: 60 VDDSTQ 65 Score = 55.6 bits (128), Expect = 3e-08 Identities = 35/85 (41%), Positives = 44/85 (51%) Frame = +1 Query: 256 VDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILG 435 VDIV RL E + DKK + Y+K Y+K L KL E+ DQ VFK + K +L Sbjct: 68 VDIVDTFRLQEQPTY-DKKGFIAYIKKYIKLLTPKLSEE--DQA-VFKKGIEGATKFLLP 123 Query: 436 RFKELQFFTGESMDCDGMVAMMEYK 510 R + QFF GE M D + YK Sbjct: 124 RLSDFQFFVGEGMHDDSTLVFAYYK 148 >At3g05540.1 68416.m00607 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 156 Score = 55.2 bits (127), Expect = 4e-08 Identities = 28/74 (37%), Positives = 46/74 (62%) Frame = +1 Query: 256 VDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILG 435 VDI+ RL E +F DKK + +++K Y+K+L KL+ + E+FK ++ K ++ Sbjct: 55 VDIIDTFRLQEQPSF-DKKQFVMFMKRYIKQLSPKLDS---ENQELFKKHIESATKFLMS 110 Query: 436 RFKELQFFTGESMD 477 + K+ QFF GESM+ Sbjct: 111 KLKDFQFFVGESME 124 Score = 36.7 bits (81), Expect = 0.017 Identities = 18/52 (34%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = +2 Query: 62 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVTRAQGDIQIEGFNPSA 214 M +Y+DI+TGDE+ SD++ K ++ +++EV G+ + +G + EG + A Sbjct: 1 MLVYQDILTGDELLSDSFPYKEIENGMLWEVEGKNPSGEEGG-EDEGVDDQA 51 >At4g29060.1 68417.m04157 elongation factor Ts family protein similar to SP|P35019 Elongation factor Ts (EF-Ts) {Galdieria sulphuraria}; contains Pfam profiles PF00627: UBA/TS-N domain, PF00889: Elongation factor TS, PF00575: S1 RNA binding domain Length = 953 Score = 32.7 bits (71), Expect = 0.27 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Frame = +2 Query: 89 GDEMFSDTYKMKLVDEVIYEVT--GRLVTRAQGDIQIEGFNPSAEEADEGTDS 241 G+ S K +++D V+ +T G +T +G+ EGF P+AEEAD+G S Sbjct: 238 GEGFNSKFAKGQMLDGVVKNLTRSGAFITIGEGE---EGFLPTAEEADDGIGS 287 >At2g17050.1 68415.m01968 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1355 Score = 31.1 bits (67), Expect = 0.83 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +1 Query: 334 DYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQ-FFTGESMD 477 D M+ + KL P +EVFK+N N + ++ F ++ FF GE D Sbjct: 226 DKMEVKLLKLNHPPPQIMEVFKSNYNALNENEKSMFLDIACFFRGEKAD 274 >At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 383 Score = 29.5 bits (63), Expect = 2.5 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 520 PSKSYIPSWQPCHHNPWTP 464 P +++ P WQP H N W P Sbjct: 79 PPQNHYPPWQPHHGNQWRP 97 >At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 661 Score = 29.5 bits (63), Expect = 2.5 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 520 PSKSYIPSWQPCHHNPWTP 464 P +++ P WQP H N W P Sbjct: 79 PPQNHYPPWQPHHGNQWRP 97 >At1g63910.1 68414.m07236 myb family transcription factor (MYB103) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 370 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = -3 Query: 172 SRHQPTGHFVNNFIDQFHFVSVREHLITSDNVLIDLHFDGLEAIKNNKNRKN 17 SRHQP+ V D + E T+ + + +LHFDG N N N Sbjct: 124 SRHQPSVTTVTLNADTTSIATTIEASTTTTSTIDNLHFDGFTDSPNQLNFTN 175 >At1g43760.1 68414.m05034 hypothetical protein Length = 626 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 595 NSIIPNWRLDTFVFLFIYQSCPHPGRNWLLSSQG*TILYFKK 720 +S +P+WRLDT C GR W++ ++L FKK Sbjct: 181 DSTLPSWRLDT------NYCCSELGRIWIVWDPSVSVLVFKK 216 >At1g80960.3 68414.m09501 F-box protein-related contains weak hit to Pfam PF00646: F-box domain Length = 462 Score = 27.9 bits (59), Expect = 7.7 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = -3 Query: 613 SLELLSYFLSNI*NFS---SSRPCLKNIMIGICVPSKSYIP 500 +L+LLS I F+ +S PCL+ +++GIC KS +P Sbjct: 213 TLKLLSIVAPEIGVFNRVLASCPCLEVLVLGICCFKKSRVP 253 >At1g80960.2 68414.m09500 F-box protein-related contains weak hit to Pfam PF00646: F-box domain Length = 486 Score = 27.9 bits (59), Expect = 7.7 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = -3 Query: 613 SLELLSYFLSNI*NFS---SSRPCLKNIMIGICVPSKSYIP 500 +L+LLS I F+ +S PCL+ +++GIC KS +P Sbjct: 213 TLKLLSIVAPEIGVFNRVLASCPCLEVLVLGICCFKKSRVP 253 >At1g80960.1 68414.m09499 F-box protein-related contains weak hit to Pfam PF00646: F-box domain Length = 486 Score = 27.9 bits (59), Expect = 7.7 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = -3 Query: 613 SLELLSYFLSNI*NFS---SSRPCLKNIMIGICVPSKSYIP 500 +L+LLS I F+ +S PCL+ +++GIC KS +P Sbjct: 213 TLKLLSIVAPEIGVFNRVLASCPCLEVLVLGICCFKKSRVP 253 >At1g08710.1 68414.m00967 F-box family protein similar to ESTs gb|T22270 and gb|T76886 ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 274 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = -3 Query: 346 FSYSL*GTMCRISCHRRRMFRLACGSGLCQLAL 248 FSY +C IS RR+FRL+C L L L Sbjct: 24 FSYK---DLCCISISSRRLFRLSCDDSLWDLLL 53 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,826,403 Number of Sequences: 28952 Number of extensions: 316481 Number of successful extensions: 834 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 831 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -