BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30007 (533 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: L... 117 2e-25 UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Bet... 117 2e-25 UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; ... 115 8e-25 UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organ... 105 6e-22 UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep:... 77 3e-13 UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryo... 76 6e-13 UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; ... 68 1e-10 UniRef50_P06219 Cluster: Beta-galactosidase; n=11; Gammaproteoba... 58 1e-07 UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia sp... 57 3e-07 UniRef50_P81650 Cluster: Beta-galactosidase; n=26; Gammaproteoba... 54 2e-06 UniRef50_A6FJQ2 Cluster: 50S ribosomal protein L5; n=8; Bacteria... 52 1e-05 UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barre... 48 2e-04 UniRef50_A6DI70 Cluster: Beta-D-galactosidase; n=1; Lentisphaera... 43 0.005 UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio choler... 42 0.007 UniRef50_A0M224 Cluster: Beta-galactosidase; n=1; Gramella forse... 42 0.007 UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barre... 41 0.015 UniRef50_A7LU08 Cluster: Putative uncharacterized protein; n=1; ... 40 0.027 UniRef50_Q1II16 Cluster: Glycoside hydrolase family 2, TIM barre... 39 0.062 UniRef50_Q15NH4 Cluster: Glycoside hydrolase family 2, TIM barre... 38 0.14 UniRef50_A5FCG4 Cluster: Beta-galactosidase precursor; n=1; Flav... 37 0.25 UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ... 37 0.25 UniRef50_A7CVC4 Cluster: Beta-galactosidase; n=1; Opitutaceae ba... 37 0.33 UniRef50_Q8A2G5 Cluster: Beta-galactosidase; n=8; Bacteroidales|... 36 0.44 UniRef50_A3XMD4 Cluster: Beta-galactosidase; n=1; Leeuwenhoekiel... 36 0.58 UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus la... 36 0.58 UniRef50_Q2VT50 Cluster: Beta-galactosidase precursor; n=2; Flav... 36 0.77 UniRef50_A2VBJ9 Cluster: Non-ribosomal peptide synthetase; n=1; ... 35 1.3 UniRef50_A4RLN6 Cluster: Putative uncharacterized protein; n=2; ... 35 1.3 UniRef50_O52847 Cluster: Beta-galactosidase; n=3; Bacillus megat... 35 1.3 UniRef50_Q5DC94 Cluster: SJCHGC09076 protein; n=1; Schistosoma j... 34 2.3 UniRef50_Q9K9C6 Cluster: Beta-galactosidase; n=6; Firmicutes|Rep... 34 2.3 UniRef50_Q1NHI7 Cluster: Beta-galactosidase; n=1; Sphingomonas s... 33 3.1 UniRef50_A4AN51 Cluster: Beta-galactosidase; n=1; Flavobacterial... 33 4.1 UniRef50_A7BPF2 Cluster: LacZ alpha peptide; n=1; Beggiatoa sp. ... 33 5.4 UniRef50_A6G4K3 Cluster: Putative uncharacterized protein; n=1; ... 33 5.4 UniRef50_Q4X214 Cluster: C6 finger domain protein, putative; n=7... 33 5.4 UniRef50_UPI0000F1EDC6 Cluster: PREDICTED: hypothetical protein;... 32 7.2 UniRef50_UPI000038DE68 Cluster: COG0457: FOG: TPR repeat; n=1; N... 32 7.2 UniRef50_Q830R3 Cluster: Glycosyl hydrolase, family 2; n=1; Ente... 32 7.2 UniRef50_A6KX57 Cluster: Glycoside hydrolase family 2; n=1; Bact... 32 7.2 UniRef50_Q2UM73 Cluster: Predicted protein; n=7; Trichocomaceae|... 32 7.2 UniRef50_Q84CN9 Cluster: 3-phytase; n=4; Enterobacteriaceae|Rep:... 32 9.5 UniRef50_A3UI41 Cluster: ECF-family sigma factor; n=1; Oceanicau... 32 9.5 UniRef50_Q5CYC7 Cluster: Uncharacterized protein with predicted ... 32 9.5 >UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: LacZ protein - Phage M13mp18 Length = 102 Score = 117 bits (281), Expect = 2e-25 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 226 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 78 >UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Beta-galactosidase - Escherichia coli (strain K12) Length = 1024 Score = 117 bits (281), Expect = 2e-25 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 226 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+ Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60 >UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; Erwinia amylovora|Rep: Putative uncharacterized protein - Erwinia amylovora (Fire blight bacteria) Length = 123 Score = 115 bits (276), Expect = 8e-25 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 226 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR LNGEW+ Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNGEWR 120 >UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organisms|Rep: LacZ-alpha peptide - Escherichia coli Length = 90 Score = 105 bits (252), Expect = 6e-22 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 211 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 69 >UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep: Beta-galactosidase - Yersinia pseudotuberculosis Length = 1066 Score = 76.6 bits (180), Expect = 3e-13 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 223 L +L RRDWENP +TQ +RL AHPPF SWR+ E A+ DRPS Q ++LNG W Sbjct: 15 LPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQTLNGLW 66 >UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryota|Rep: beta-galactosidase - Entamoeba histolytica HM-1:IMSS Length = 86 Score = 75.8 bits (178), Expect = 6e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 66 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAK 170 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVI++ Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVISE 39 Score = 35.5 bits (78), Expect = 0.77 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = +2 Query: 164 SEEARTDRPSQQLRSLNGEWQI 229 SEEARTDRPSQQLRSL +W++ Sbjct: 38 SEEARTDRPSQQLRSL--KWRM 57 >UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; Enterobacter sakazakii ATCC BAA-894|Rep: Putative uncharacterized protein - Enterobacter sakazakii ATCC BAA-894 Length = 1043 Score = 68.1 bits (159), Expect = 1e-10 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 226 LA +L R DW+NP +T +NRL +H P WR+++ AR PS + SL+GEWQ Sbjct: 18 LATILARNDWQNPAITSVNRLPSHTPLHGWRDADRARRGEPSDAVLSLDGEWQ 70 >UniRef50_P06219 Cluster: Beta-galactosidase; n=11; Gammaproteobacteria|Rep: Beta-galactosidase - Klebsiella pneumoniae Length = 1034 Score = 58.4 bits (135), Expect = 1e-07 Identities = 26/47 (55%), Positives = 31/47 (65%) Frame = +2 Query: 77 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 217 VL R DW N +T LNRL AHP FASWR+ AR + PS + R L+G Sbjct: 17 VLAREDWHNQTITHLNRLPAHPVFASWRDELAARDNLPSSRRRQLDG 63 >UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia spumigena CCY 9414|Rep: Beta-D-galactosidase - Nodularia spumigena CCY 9414 Length = 72 Score = 56.8 bits (131), Expect = 3e-07 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = +2 Query: 155 WRNSEEARTDRPSQQLRSLNGEWQIV 232 WRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 47 WRNSEEARTDRPSQQLRSLNGEWRLM 72 >UniRef50_P81650 Cluster: Beta-galactosidase; n=26; Gammaproteobacteria|Rep: Beta-galactosidase - Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) Length = 1039 Score = 54.0 bits (124), Expect = 2e-06 Identities = 22/49 (44%), Positives = 34/49 (69%) Frame = +2 Query: 77 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 223 ++ RRDWENP Q+N++ AH P ++ E+AR + SQ+ +SLNG+W Sbjct: 7 IINRRDWENPITVQVNQVKAHSPLNGFKTIEDARENTQSQK-KSLNGQW 54 >UniRef50_A6FJQ2 Cluster: 50S ribosomal protein L5; n=8; Bacteria|Rep: 50S ribosomal protein L5 - Moritella sp. PE36 Length = 45 Score = 51.6 bits (118), Expect = 1e-05 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -2 Query: 232 YNLPFAIQAAQLLGRAIGAGLFAITPAGERG 140 + PFAIQAAQLLGRAIGAGLFAITP E G Sbjct: 8 HQAPFAIQAAQLLGRAIGAGLFAITPEFELG 38 >UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barrel precursor; n=1; Pseudoalteromonas atlantica T6c|Rep: Glycoside hydrolase family 2, TIM barrel precursor - Pseudoalteromonas atlantica (strain T6c / BAA-1087) Length = 1079 Score = 47.6 bits (108), Expect = 2e-04 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = +2 Query: 86 RRDWENPGVTQLNRLAAHPPFASWRNSEEART-DRPSQQLRSLNGEWQ 226 + DWENP V Q+NRL A S+ E+A T DR ++SLNG+W+ Sbjct: 31 KNDWENPDVIQINRLPARATSYSFDTPEQALTRDRNQSTIQSLNGQWK 78 >UniRef50_A6DI70 Cluster: Beta-D-galactosidase; n=1; Lentisphaera araneosa HTCC2155|Rep: Beta-D-galactosidase - Lentisphaera araneosa HTCC2155 Length = 991 Score = 42.7 bits (96), Expect = 0.005 Identities = 20/49 (40%), Positives = 24/49 (48%) Frame = +2 Query: 95 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVN 241 WENP LN LA PP S+ + E+A S + SLNG W N Sbjct: 6 WENPQFVSLNTLAPRPPLYSFDSLEKALEQDQSAYIHSLNGSWNFKLFN 54 >UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio cholerae|Rep: Beta-galactosidase - Vibrio cholerae Length = 56 Score = 42.3 bits (95), Expect = 0.007 Identities = 18/50 (36%), Positives = 30/50 (60%) Frame = +2 Query: 77 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 226 +L +DW+NP + + + H P S+R +EAR D + +SLNG+W+ Sbjct: 7 ILLSQDWQNPHIVKWHCRTPHVPLHSYRTEQEARLDVGGNR-QSLNGQWR 55 >UniRef50_A0M224 Cluster: Beta-galactosidase; n=1; Gramella forsetii KT0803|Rep: Beta-galactosidase - Gramella forsetii (strain KT0803) Length = 1049 Score = 42.3 bits (95), Expect = 0.007 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +2 Query: 92 DWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEWQ 226 DWENP VT +N+L A S+ N + A S +++SLNG WQ Sbjct: 26 DWENPAVTGINKLPARATMYSFSNKQAAINLNKENSDRVKSLNGTWQ 72 >UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barrel; n=1; Clostridium cellulolyticum H10|Rep: Glycoside hydrolase family 2, TIM barrel - Clostridium cellulolyticum H10 Length = 1033 Score = 41.1 bits (92), Expect = 0.015 Identities = 17/48 (35%), Positives = 31/48 (64%), Gaps = 2/48 (4%) Frame = +2 Query: 89 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDR--PSQQLRSLNGEWQ 226 R+WEN +TQ+NR H P+ ++ + E+A + S+ ++SL+G W+ Sbjct: 3 REWENQYITQINRYPMHSPYGAYESVEQAMSCNRWTSKYVKSLSGIWK 50 >UniRef50_A7LU08 Cluster: Putative uncharacterized protein; n=1; Bacteroides ovatus ATCC 8483|Rep: Putative uncharacterized protein - Bacteroides ovatus ATCC 8483 Length = 1046 Score = 40.3 bits (90), Expect = 0.027 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +2 Query: 83 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP--SQQLRSLNGEWQIV 232 Q +WENP + N+ H F + +E+A D+P S SLNG W+ + Sbjct: 26 QNNEWENPAKYEWNKERPHADFRLYEQAEDAVNDKPRKSSWQHSLNGVWKFI 77 >UniRef50_Q1II16 Cluster: Glycoside hydrolase family 2, TIM barrel precursor; n=1; Acidobacteria bacterium Ellin345|Rep: Glycoside hydrolase family 2, TIM barrel precursor - Acidobacteria bacterium (strain Ellin345) Length = 1049 Score = 39.1 bits (87), Expect = 0.062 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +2 Query: 83 QRRDWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEWQ 226 Q DWENP V +NR A F + + A R ++PS ++SLNG W+ Sbjct: 21 QTPDWENPRVFGINREAPRATFTPFPDEASALKRREQPSVFMQSLNGMWK 70 >UniRef50_Q15NH4 Cluster: Glycoside hydrolase family 2, TIM barrel; n=1; Pseudoalteromonas atlantica T6c|Rep: Glycoside hydrolase family 2, TIM barrel - Pseudoalteromonas atlantica (strain T6c / BAA-1087) Length = 1045 Score = 37.9 bits (84), Expect = 0.14 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +2 Query: 92 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRP--SQQLRSLNGEW 223 DW+NP V +N+ A F + + + D P SQ SLNGEW Sbjct: 11 DWQNPEVFAINKEPARSSFYGFSDDPQGYVDSPFMSQDYLSLNGEW 56 >UniRef50_A5FCG4 Cluster: Beta-galactosidase precursor; n=1; Flavobacterium johnsoniae UW101|Rep: Beta-galactosidase precursor - Flavobacterium johnsoniae UW101 Length = 1108 Score = 37.1 bits (82), Expect = 0.25 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Frame = +2 Query: 95 WENPGVTQLNRLAAHPPFASWRNSEEA-RTDRPSQQLRSLNGEWQI-VSVNI 244 WE+P +T +NR + S+ + E+A + DR +++ LNG+W +VN+ Sbjct: 57 WEDPTITSINRQPSRATAYSYSSVEDALKGDRTKSRIQMLNGDWDFKYAVNL 108 >UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 275 Score = 37.1 bits (82), Expect = 0.25 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 15 RGGARYPIRPIVSRIT 62 RGGARYPIRPIVSRIT Sbjct: 260 RGGARYPIRPIVSRIT 275 >UniRef50_A7CVC4 Cluster: Beta-galactosidase; n=1; Opitutaceae bacterium TAV2|Rep: Beta-galactosidase - Opitutaceae bacterium TAV2 Length = 1130 Score = 36.7 bits (81), Expect = 0.33 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +2 Query: 95 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR--SLNGEWQ 226 WE P +T LN+L F + + +EAR + + R SLNG WQ Sbjct: 10 WEAPELTSLNKLPPRATFHGFGSVKEARAGKSEKSTRHHSLNGTWQ 55 >UniRef50_Q8A2G5 Cluster: Beta-galactosidase; n=8; Bacteroidales|Rep: Beta-galactosidase - Bacteroides thetaiotaomicron Length = 1036 Score = 36.3 bits (80), Expect = 0.44 Identities = 15/47 (31%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 92 DWENPGVTQLNRLAAHPPFASWRNSEEAR--TDRPSQQLRSLNGEWQ 226 +W++P V +NR A H + ++ +++EA+ + SQ +LNG W+ Sbjct: 26 EWKDPEVNSVNRSAMHTNYFAYASADEAKAGSKEDSQNFMTLNGLWK 72 >UniRef50_A3XMD4 Cluster: Beta-galactosidase; n=1; Leeuwenhoekiella blandensis MED217|Rep: Beta-galactosidase - Leeuwenhoekiella blandensis MED217 Length = 1033 Score = 35.9 bits (79), Expect = 0.58 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +2 Query: 83 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ--LRSLNGEWQ 226 Q+ +WENP + N+ F + +++A+T SQ +SLNG W+ Sbjct: 20 QQNEWENPKIIDRNKEEGRASFVLFEKTQKAKTRDASQSQFYKSLNGVWK 69 >UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus lactis|Rep: Beta-galactosidase - Lactococcus lactis subsp. lactis (Streptococcus lactis) Length = 998 Score = 35.9 bits (79), Expect = 0.58 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 77 VLQRRDWENPGVTQLNRLAAHPP 145 VL+R+DWENP V+ NRL H P Sbjct: 9 VLERKDWENPVVSNWNRLPMHTP 31 >UniRef50_Q2VT50 Cluster: Beta-galactosidase precursor; n=2; Flavobacterium|Rep: Beta-galactosidase precursor - Flavobacterium sp. 4214 Length = 1046 Score = 35.5 bits (78), Expect = 0.77 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +2 Query: 86 RRDWENPGVTQLNRLAAHPPFASWRNSEEARTD--RPSQQLRSLNGEWQ 226 R DWENP V Q+NR A F + + A D S SL+G+W+ Sbjct: 28 RNDWENPEVFQINREPARAAFLPFADEASAIADDYTRSPWYMSLDGKWK 76 >UniRef50_A2VBJ9 Cluster: Non-ribosomal peptide synthetase; n=1; uncultured bacterium|Rep: Non-ribosomal peptide synthetase - uncultured bacterium Length = 338 Score = 34.7 bits (76), Expect = 1.3 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = -3 Query: 117 WVTPGFSQSRRCKTTASEL*YDSL*GELGTGPPLETSSL 1 W GF C YDSL GELGTGPPLE + Sbjct: 260 WSKTGFRPF--CLEAGRRAYYDSLYGELGTGPPLEVDGI 296 >UniRef50_A4RLN6 Cluster: Putative uncharacterized protein; n=2; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 1047 Score = 34.7 bits (76), Expect = 1.3 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 92 DWENPGVTQLNRLAAHPPFASWRNSEEART-DRPSQQLRSLNGEWQ 226 DW N V N L A F S+ + A T DR + SLNG W+ Sbjct: 9 DWSNLAVLHTNALPARAHFYSYASETAALTHDRHQSEYHSLNGTWK 54 >UniRef50_O52847 Cluster: Beta-galactosidase; n=3; Bacillus megaterium|Rep: Beta-galactosidase - Bacillus megaterium Length = 1034 Score = 34.7 bits (76), Expect = 1.3 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = +2 Query: 92 DWEN-PGVTQLNRLAAHPPFASWRNSEEA-RTDRPSQ-QLRSLNGEW 223 +W N P + QLNR AH ++ EEA + DR S +SLNG W Sbjct: 19 EWNNNPEIFQLNRSKAHALLMPYQTVEEALKNDRKSSVYYQSLNGSW 65 >UniRef50_Q5DC94 Cluster: SJCHGC09076 protein; n=1; Schistosoma japonicum|Rep: SJCHGC09076 protein - Schistosoma japonicum (Blood fluke) Length = 109 Score = 33.9 bits (74), Expect = 2.3 Identities = 19/52 (36%), Positives = 28/52 (53%) Frame = +2 Query: 71 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 226 A L+RR+ +NPG QLN L A P F +++A +R S+ G+ Q Sbjct: 57 AAFLKRREGKNPGCPQLNPLEALPLFPGGEKTKKAPPNRLSKNWPPPEGQRQ 108 Score = 32.7 bits (71), Expect = 5.4 Identities = 20/55 (36%), Positives = 24/55 (43%) Frame = +3 Query: 18 GGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAP 182 GGAR PI P I +F GK P L L+ +PL P G K+ P Sbjct: 39 GGARDPISPKGGPNKISGAAFLKRREGKNPGCPQLNPLEALPLFPGGEKTKKAPP 93 >UniRef50_Q9K9C6 Cluster: Beta-galactosidase; n=6; Firmicutes|Rep: Beta-galactosidase - Bacillus halodurans Length = 1014 Score = 33.9 bits (74), Expect = 2.3 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 110 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 226 V +NRL AH + EEA+ + P SLNG W+ Sbjct: 15 VFAVNRLPAHSDHVYYETVEEAKKEPPMSMRHSLNGHWK 53 >UniRef50_Q1NHI7 Cluster: Beta-galactosidase; n=1; Sphingomonas sp. SKA58|Rep: Beta-galactosidase - Sphingomonas sp. SKA58 Length = 1078 Score = 33.5 bits (73), Expect = 3.1 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = +2 Query: 86 RRDWENPGVTQLNRLAAHP---PFASWRNSEEARTDRPSQQLRSLNGEWQ 226 R DWENP V + +L A PF S R++ A S++ SLNG W+ Sbjct: 39 RPDWENPAVFAIGKLPARATAFPFES-RDAALAGDRSRSRRFLSLNGPWK 87 >UniRef50_A4AN51 Cluster: Beta-galactosidase; n=1; Flavobacteriales bacterium HTCC2170|Rep: Beta-galactosidase - Flavobacteriales bacterium HTCC2170 Length = 1126 Score = 33.1 bits (72), Expect = 4.1 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +2 Query: 92 DWENPGVTQLNRLAAHPPFASWRNSEEART--DRPSQQLRSLNGEW 223 DWENP + +N+L H F +++ E A + S + + LNG W Sbjct: 27 DWENPEIFGINKLEPHAFFIPFQSQESALSFDATRSDRYQLLNGYW 72 >UniRef50_A7BPF2 Cluster: LacZ alpha peptide; n=1; Beggiatoa sp. SS|Rep: LacZ alpha peptide - Beggiatoa sp. SS Length = 73 Score = 32.7 bits (71), Expect = 5.4 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -1 Query: 524 GAPFRVRFXALRHLDPKKL 468 G P RF ALRHLDPKKL Sbjct: 54 GLPLGFRFSALRHLDPKKL 72 >UniRef50_A6G4K3 Cluster: Putative uncharacterized protein; n=1; Plesiocystis pacifica SIR-1|Rep: Putative uncharacterized protein - Plesiocystis pacifica SIR-1 Length = 531 Score = 32.7 bits (71), Expect = 5.4 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +3 Query: 90 VTGKTLALPNLIALQHIPLSPAGVIAKRPAPIAL 191 V+G L LP+L+ PL P G++A++ PIAL Sbjct: 64 VSGPNLQLPHLVDELATPLPPTGLLARKMDPIAL 97 >UniRef50_Q4X214 Cluster: C6 finger domain protein, putative; n=7; Trichocomaceae|Rep: C6 finger domain protein, putative - Aspergillus fumigatus (Sartorya fumigata) Length = 1148 Score = 32.7 bits (71), Expect = 5.4 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 PVNCNTTHYRANWVPGPPSRLVL 3 PV N +R W+PGPP+R VL Sbjct: 619 PVTDNPPDFRKEWIPGPPTRSVL 641 >UniRef50_UPI0000F1EDC6 Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 195 Score = 32.3 bits (70), Expect = 7.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 68 LAVVLQRRDWENP 106 LAVVLQRRDWENP Sbjct: 179 LAVVLQRRDWENP 191 >UniRef50_UPI000038DE68 Cluster: COG0457: FOG: TPR repeat; n=1; Nostoc punctiforme PCC 73102|Rep: COG0457: FOG: TPR repeat - Nostoc punctiforme PCC 73102 Length = 532 Score = 32.3 bits (70), Expect = 7.2 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +2 Query: 68 LAVVLQRRDWENPGVTQLNRLAAH-PPFASWRNSEEA 175 + V+L+ DWE P + QL+ L ++ P SW + +EA Sbjct: 96 IPVLLRYADWETPPIDQLSPLPSNRKPIKSWNDRDEA 132 >UniRef50_Q830R3 Cluster: Glycosyl hydrolase, family 2; n=1; Enterococcus faecalis|Rep: Glycosyl hydrolase, family 2 - Enterococcus faecalis (Streptococcus faecalis) Length = 1025 Score = 32.3 bits (70), Expect = 7.2 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +2 Query: 89 RDWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEWQIV 232 + WEN V +NRL F+S+ + E A ++ +Q ++LNG W + Sbjct: 2 KTWENYKVDSINRLPGRAHFSSFPSKETALLNENKYTQAYKNLNGCWHFL 51 >UniRef50_A6KX57 Cluster: Glycoside hydrolase family 2; n=1; Bacteroides vulgatus ATCC 8482|Rep: Glycoside hydrolase family 2 - Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) Length = 1076 Score = 32.3 bits (70), Expect = 7.2 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +2 Query: 92 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ--LRSLNGEWQ 226 DWEN V +NRL + F + E A SQ +SLNG W+ Sbjct: 55 DWENFDVLHINRLPSAANFMGYPTKELALQGDKSQSPYFQSLNGTWK 101 >UniRef50_Q2UM73 Cluster: Predicted protein; n=7; Trichocomaceae|Rep: Predicted protein - Aspergillus oryzae Length = 167 Score = 32.3 bits (70), Expect = 7.2 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +2 Query: 140 PPFASWRNSEEARTDRPSQQLRSLNGE 220 PP +S RN E R ++P+ LR+L+GE Sbjct: 56 PPSSSSRNDESQREEKPAPHLRNLSGE 82 >UniRef50_Q84CN9 Cluster: 3-phytase; n=4; Enterobacteriaceae|Rep: 3-phytase - Klebsiella pneumoniae Length = 421 Score = 31.9 bits (69), Expect = 9.5 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +2 Query: 92 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 220 DW+ V +L+R PP A R + EA T RP + + +GE Sbjct: 29 DWQLEKVVELSRHGIRPPTAGNREAIEAATGRPWTEWTTHDGE 71 >UniRef50_A3UI41 Cluster: ECF-family sigma factor; n=1; Oceanicaulis alexandrii HTCC2633|Rep: ECF-family sigma factor - Oceanicaulis alexandrii HTCC2633 Length = 402 Score = 31.9 bits (69), Expect = 9.5 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 2/76 (2%) Frame = +1 Query: 304 IGKIPYKSKE*TEIGLSVVPVWNKSPLLKNVDSNVKGRKTVYQGDGPLREPSP--*SSFL 477 +G+ Y S+ TE+ + VW L+ + ++ R+ PL E P + L Sbjct: 203 VGEALYLSRLLTELAPEIADVWGLYALIAHCEARTPARRDAEGRFIPLSEQDPQLWDAAL 262 Query: 478 GSRCRKALNRTLKGAP 525 S+ AL R+LK AP Sbjct: 263 ISQAENALRRSLKLAP 278 >UniRef50_Q5CYC7 Cluster: Uncharacterized protein with predicted coiled coil regions; n=2; Cryptosporidium|Rep: Uncharacterized protein with predicted coiled coil regions - Cryptosporidium parvum Iowa II Length = 825 Score = 31.9 bits (69), Expect = 9.5 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +3 Query: 336 DRDRVECCSSLEQESTIKERGLQRQRAKNRL 428 +RD V C S+ Q+S IKER L+ ++ K +L Sbjct: 128 ERDNVSKCLSIRQQSLIKERELRLEKTKLKL 158 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 571,050,232 Number of Sequences: 1657284 Number of extensions: 11849874 Number of successful extensions: 28491 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 27798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28483 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 33739557507 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -