BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30005 (488 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 151 3e-39 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 5.3 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 5.3 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 5.3 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 151 bits (367), Expect = 3e-39 Identities = 67/70 (95%), Positives = 69/70 (98%) Frame = +1 Query: 46 MAIRPVYRPTIVKKRTKRFIRHQSDRYDKLKRNWRKPRGIDNRVRRRFKGQYLMPNIGYG 225 MAIRPVYRPTIVKKRTK+FIRHQSDRY KLKRNWRKP+GIDNRVRRRFKGQYLMPNIGYG Sbjct: 1 MAIRPVYRPTIVKKRTKKFIRHQSDRYSKLKRNWRKPKGIDNRVRRRFKGQYLMPNIGYG 60 Query: 226 SNKKTRHMLP 255 SNKKTRHMLP Sbjct: 61 SNKKTRHMLP 70 Score = 114 bits (274), Expect = 5e-28 Identities = 56/65 (86%), Positives = 59/65 (90%) Frame = +3 Query: 252 PNGFRKVLVHNVKELEILMMXNRXYCAEIAHGVSSKKRKLIVERAQQLSIRVTNAAARLR 431 P GFRKVLVHNVKELE+LMM NR +CAEIAHG SSKKRK IVERAQQLSIRVT A+ARLR Sbjct: 70 PTGFRKVLVHNVKELEVLMMQNRKFCAEIAHGGSSKKRKSIVERAQQLSIRVTYASARLR 129 Query: 432 SQENE 446 SQENE Sbjct: 130 SQENE 134 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 5.3 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -1 Query: 467 LIIQLYLFILLGAEASGRI 411 L + +LF++ ++SGRI Sbjct: 15 LFVNSFLFVIAAQDSSGRI 33 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 5.3 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -1 Query: 467 LIIQLYLFILLGAEASGRI 411 L + +LF++ ++SGRI Sbjct: 15 LFVNSFLFVIAAQDSSGRI 33 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 5.3 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -1 Query: 467 LIIQLYLFILLGAEASGRI 411 L + +LF++ ++SGRI Sbjct: 15 LFVNSFLFVIAAQDSSGRI 33 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,080 Number of Sequences: 438 Number of extensions: 2368 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13421061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -