BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30001 (734 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0433 - 22891261-22891509,22892181-22892301,22892405-228924... 66 3e-11 04_04_0211 - 23636377-23636532,23636624-23636805,23637853-236379... 65 5e-11 02_02_0470 - 10700092-10700505 30 2.2 01_07_0084 + 40976976-40977164,40978174-40978201,40978445-409785... 29 2.9 10_08_0951 - 21769342-21769752 29 5.1 >02_04_0433 - 22891261-22891509,22892181-22892301,22892405-22892496, 22892692-22892755,22892855-22892920,22893102-22893193, 22893991-22894050,22894181-22894270,22894484-22894613, 22895066-22895157,22895299-22895373,22895663-22895754, 22896496-22896586,22897541-22897574,22897745-22897791, 22899110-22899209,22899300-22899436,22900837-22901015, 22901146-22901188,22901264-22901297,22901839-22901948, 22902043-22902224,22903062-22903168,22903266-22903480 Length = 833 Score = 66.1 bits (154), Expect = 3e-11 Identities = 37/76 (48%), Positives = 48/76 (63%), Gaps = 1/76 (1%) Frame = +3 Query: 279 FYPTQE-KIRASSGGRPFSKHVRRIRPNLKIGTVCILLAGRHAGKRVVLVGILPSGLLLV 455 FYP + K RA S + + ++R + GTV ILLAGR+ GKRVV + L SGLLL+ Sbjct: 50 FYPADDVKPRAPSTRKA---NPTKLRSTITPGTVLILLAGRYMGKRVVFLKQLKSGLLLI 106 Query: 456 TGPFAFNSCPLRRIPQ 503 TGPF N P+RR+ Q Sbjct: 107 TGPFKINGVPIRRVNQ 122 >04_04_0211 - 23636377-23636532,23636624-23636805,23637853-23637959, 23637997-23638280 Length = 242 Score = 65.3 bits (152), Expect = 5e-11 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 2/75 (2%) Frame = +3 Query: 285 PTQEKIRASSGGRPFS--KHVRRIRPNLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVT 458 PT+ + +SS FS + + +R ++ GTV ILLAGR GKRVV + L SGLLLVT Sbjct: 71 PTKLRSPSSSNLPEFSLFRFILLMRSSITPGTVLILLAGRFMGKRVVFLKQLKSGLLLVT 130 Query: 459 GPFAFNSCPLRRIPQ 503 GPF N P+RR+ Q Sbjct: 131 GPFKINGVPIRRVNQ 145 >02_02_0470 - 10700092-10700505 Length = 137 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 360 LKIGTVCILLAGRHAGKRVVLVGILPSG 443 LK G ILL GR+AG++ V+V + G Sbjct: 5 LKPGKAVILLQGRYAGRKAVIVRVFEEG 32 >01_07_0084 + 40976976-40977164,40978174-40978201,40978445-40978575, 40978941-40979434,40979516-40979609,40979686-40979779, 40980342-40980444,40980550-40980601,40980716-40980756, 40980881-40980960,40981490-40981936,40982378-40982554, 40983205-40983803,40983886-40985040 Length = 1227 Score = 29.5 bits (63), Expect = 2.9 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +3 Query: 522 PPEFHSATSNCQNTSMMITSRRIRSASNVQSNAKRVMTSLPQKKRNTFPSEQ 677 PP S + N + S+ SAS + + + MTSLPQ + PS Q Sbjct: 871 PPVASSVQQSFSNVVSSLPSQPYASASALPAQTRTNMTSLPQSMISVNPSTQ 922 >10_08_0951 - 21769342-21769752 Length = 136 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 360 LKIGTVCILLAGRHAGKRVVLVGILPSG 443 LK G ILL GR AG++ V+V + G Sbjct: 5 LKPGKAVILLQGRFAGRKAVIVRVFEEG 32 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,663,081 Number of Sequences: 37544 Number of extensions: 410225 Number of successful extensions: 946 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 946 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1933531792 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -