BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30001 (734 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 24 5.6 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 7.4 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 23.8 bits (49), Expect = 5.6 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +3 Query: 333 KHVR--RIRPNLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 464 KHV+ + +LK +VC+ + +RVV GI SGL L +GP Sbjct: 109 KHVKFCQFAFDLKCDSVCV---NPYHYERVVSPGIDLSGLTLQSGP 151 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.4 bits (48), Expect = 7.4 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +3 Query: 585 RIRSASNVQSNAKRVMTSLPQKKRNTFPSEQRKTD 689 +IR AS V SNA V + P P+E+ D Sbjct: 947 KIRCASYVSSNATVVPATQPADASQASPAEEPLPD 981 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 726,069 Number of Sequences: 2352 Number of extensions: 15080 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -