BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= heS01010X
(520 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
L76687-1|AAC15861.1| 540|Homo sapiens Grb14 protein. 29 9.8
>L76687-1|AAC15861.1| 540|Homo sapiens Grb14 protein.
Length = 540
Score = 29.1 bits (62), Expect = 9.8
Identities = 18/63 (28%), Positives = 31/63 (49%)
Frame = +2
Query: 59 YVECKCKP*ITSAIKEDLVDHRSLNGKEVVVVITEDFVIRDLSIIDLNRDKEVNGLVMRR 238
+ E C P ITS + DL + K+V+ V +ED R L + ++V L++ +
Sbjct: 82 FPELCCSP-ITSVLSADLFPKANSRKKQVIKVYSEDETSRALDVPSDITARDVCQLLILK 140
Query: 239 QHH 247
H+
Sbjct: 141 NHY 143
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 36,884,722
Number of Sequences: 237096
Number of extensions: 400099
Number of successful extensions: 649
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 649
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 649
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4933413474
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -