SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS00794
         (311 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC19G7.03c |rps3002|rps30-2, rps30|40S ribosomal protein S30|S...    24   4.6  
SPAC19B12.04 |rps3001|rps30-1|40S ribosomal protein S30|Schizosa...    24   4.6  
SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||...    24   6.1  

>SPBC19G7.03c |rps3002|rps30-2, rps30|40S ribosomal protein
           S30|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 61

 Score = 24.2 bits (50), Expect = 4.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +2

Query: 224 GKVHGSLARA 253
           GKVHGSLARA
Sbjct: 2   GKVHGSLARA 11


>SPAC19B12.04 |rps3001|rps30-1|40S ribosomal protein
           S30|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 61

 Score = 24.2 bits (50), Expect = 4.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +2

Query: 224 GKVHGSLARA 253
           GKVHGSLARA
Sbjct: 2   GKVHGSLARA 11


>SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1461

 Score = 23.8 bits (49), Expect = 6.1
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = -2

Query: 106 KSTNAFLDLTNGLLAIDVQDVCRLPSDMQL 17
           + T+  +D     LA+ ++D+C  P D+QL
Sbjct: 337 EDTDCLIDYLVATLAL-IRDLCAAPPDLQL 365


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,066,293
Number of Sequences: 5004
Number of extensions: 15611
Number of successful extensions: 23
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23
length of database: 2,362,478
effective HSP length: 63
effective length of database: 2,047,226
effective search space used: 81889040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -