BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00639 (600 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 1.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 1.7 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 21 7.0 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 7.0 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/43 (18%), Positives = 22/43 (51%) Frame = +2 Query: 416 IRNNSIIPNWRLDTFVFLFIYQSCPHPGRNWFSHHKAEQFCIL 544 + N+ ++ + ++ + + Q+CP P W++ +E +L Sbjct: 241 LENSGVVHVAQDESTSLVCVAQACPTPEYRWYAQTGSEPMLVL 283 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/43 (18%), Positives = 22/43 (51%) Frame = +2 Query: 416 IRNNSIIPNWRLDTFVFLFIYQSCPHPGRNWFSHHKAEQFCIL 544 + N+ ++ + ++ + + Q+CP P W++ +E +L Sbjct: 241 LENSGVVHVAQDESTSLVCVAQACPTPEYRWYAQTGSEPMLVL 283 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.4 bits (43), Expect = 7.0 Identities = 12/39 (30%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = +2 Query: 50 ADEGTDSAVESG-VDIVLNHRLVETYAFGDKKSYTLYLK 163 +DE +A++SG + +N+ L++T +GD K++ + +K Sbjct: 44 SDEKRQAAIQSGDYNYTMNY-LLDTDQWGD-KTFVIIMK 80 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 7.0 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = +1 Query: 262 GRFKELQFFTGESMDCDGMVAMMEYRDFDGTQIPIMMFFKHGL 390 G++ +Q + + + M+E RD + P + KHGL Sbjct: 73 GQYARVQQSMPDGWETEISDQMLELRDLPISGKPFQIRMKHGL 115 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,268 Number of Sequences: 438 Number of extensions: 3189 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -