BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00635X (579 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 25 0.46 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 23 2.5 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 7.6 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 25.0 bits (52), Expect = 0.46 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +1 Query: 370 YGAGYELPADLKTQTEFSTKMVFADARSINDHLYN 474 YGAGY+L A K T ST + A +N+H N Sbjct: 78 YGAGYDLAARRKNATRESTATLKA---WLNEHKKN 109 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 22.6 bits (46), Expect = 2.5 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +3 Query: 72 SSELQCERTVCARQ*GPQQGKANTQQDSRR 161 +S+L+C+R + GPQQ A+ + + R Sbjct: 64 NSDLRCKRKIQFMPYGPQQQPASVARRNAR 93 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.0 bits (42), Expect = 7.6 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = -1 Query: 192 VTGSVAVIHRH 160 VTG++ ++HRH Sbjct: 3 VTGNLGIMHRH 13 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,665 Number of Sequences: 336 Number of extensions: 2402 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -