BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00635X (579 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0665 + 21670956-21671834,21672563-21672583 28 6.2 06_03_0105 + 16693771-16693780,16693833-16693876,16694274-166943... 28 6.2 >12_02_0665 + 21670956-21671834,21672563-21672583 Length = 299 Score = 27.9 bits (59), Expect = 6.2 Identities = 19/51 (37%), Positives = 24/51 (47%) Frame = -2 Query: 290 VFGGVDNPGDVCAHRLLIGPVLMVTVLTPPSLM*LEVSLSSTDTTGILLGI 138 V G VD G++ A R G L VTV PP ++ L VS G L + Sbjct: 187 VQGHVDGTGEIAAFRAE-GDSLWVTVRAPPEILRLLVSKGFVAVDGASLTV 236 >06_03_0105 + 16693771-16693780,16693833-16693876,16694274-16694348, 16694548-16694784,16694880-16695050,16695137-16695250 Length = 216 Score = 27.9 bits (59), Expect = 6.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 190 NWKCRCHPQTRRESCWVF 137 N+ CRC P+ RR W + Sbjct: 5 NYVCRCRPENRRNKGWAY 22 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,765,853 Number of Sequences: 37544 Number of extensions: 295607 Number of successful extensions: 826 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 816 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 826 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1352600424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -