BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00630 (697 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49148-1|CAA89008.1| 159|Homo sapiens ribosomal protein L29 pro... 80 9e-15 U49083-1|AAC50647.1| 159|Homo sapiens HIP protein. 80 9e-15 U10248-1|AAC50499.1| 159|Homo sapiens ribosomal protein L29 pro... 80 9e-15 BC071909-1|AAH71909.1| 161|Homo sapiens ribosomal protein L29 p... 80 9e-15 BC071663-1|AAH71663.1| 159|Homo sapiens ribosomal protein L29 p... 80 9e-15 BC070481-1|AAH70481.1| 159|Homo sapiens ribosomal protein L29 p... 80 9e-15 BC070190-1|AAH70190.1| 159|Homo sapiens ribosomal protein L29 p... 80 9e-15 BC008926-1|AAH08926.1| 159|Homo sapiens ribosomal protein L29 p... 80 9e-15 AL450405-1|CAI16223.1| 172|Homo sapiens protein ( Human DNA seq... 80 9e-15 CR533465-1|CAG38496.1| 105|Homo sapiens RPL36 protein. 71 5e-12 BC091508-1|AAH91508.1| 105|Homo sapiens ribosomal protein L36 p... 71 5e-12 BC004971-1|AAH04971.1| 105|Homo sapiens ribosomal protein L36 p... 71 5e-12 BC003052-1|AAH03052.1| 105|Homo sapiens ribosomal protein L36 p... 71 5e-12 AB061833-1|BAB79471.1| 105|Homo sapiens ribosomal protein L36 p... 71 5e-12 AB046410-1|BAB21256.1| 32|Homo sapiens ribosomal protein L36 p... 60 7e-09 >Z49148-1|CAA89008.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 79.8 bits (188), Expect = 9e-15 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = +3 Query: 3 AKSKNHTNHNQNRKAHRNGINKPRKTRHASTLGMDPKFLRNHRFCKNGNLKPAKQL 170 AKSKNHT HNQ+RK HRNGI KPR R+ S G+DPKFLRN RF K N K K++ Sbjct: 2 AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >U49083-1|AAC50647.1| 159|Homo sapiens HIP protein. Length = 159 Score = 79.8 bits (188), Expect = 9e-15 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = +3 Query: 3 AKSKNHTNHNQNRKAHRNGINKPRKTRHASTLGMDPKFLRNHRFCKNGNLKPAKQL 170 AKSKNHT HNQ+RK HRNGI KPR R+ S G+DPKFLRN RF K N K K++ Sbjct: 2 AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >U10248-1|AAC50499.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 79.8 bits (188), Expect = 9e-15 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = +3 Query: 3 AKSKNHTNHNQNRKAHRNGINKPRKTRHASTLGMDPKFLRNHRFCKNGNLKPAKQL 170 AKSKNHT HNQ+RK HRNGI KPR R+ S G+DPKFLRN RF K N K K++ Sbjct: 2 AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >BC071909-1|AAH71909.1| 161|Homo sapiens ribosomal protein L29 protein. Length = 161 Score = 79.8 bits (188), Expect = 9e-15 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = +3 Query: 3 AKSKNHTNHNQNRKAHRNGINKPRKTRHASTLGMDPKFLRNHRFCKNGNLKPAKQL 170 AKSKNHT HNQ+RK HRNGI KPR R+ S G+DPKFLRN RF K N K K++ Sbjct: 2 AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >BC071663-1|AAH71663.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 79.8 bits (188), Expect = 9e-15 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = +3 Query: 3 AKSKNHTNHNQNRKAHRNGINKPRKTRHASTLGMDPKFLRNHRFCKNGNLKPAKQL 170 AKSKNHT HNQ+RK HRNGI KPR R+ S G+DPKFLRN RF K N K K++ Sbjct: 2 AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >BC070481-1|AAH70481.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 79.8 bits (188), Expect = 9e-15 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = +3 Query: 3 AKSKNHTNHNQNRKAHRNGINKPRKTRHASTLGMDPKFLRNHRFCKNGNLKPAKQL 170 AKSKNHT HNQ+RK HRNGI KPR R+ S G+DPKFLRN RF K N K K++ Sbjct: 2 AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >BC070190-1|AAH70190.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 79.8 bits (188), Expect = 9e-15 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = +3 Query: 3 AKSKNHTNHNQNRKAHRNGINKPRKTRHASTLGMDPKFLRNHRFCKNGNLKPAKQL 170 AKSKNHT HNQ+RK HRNGI KPR R+ S G+DPKFLRN RF K N K K++ Sbjct: 2 AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >BC008926-1|AAH08926.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 79.8 bits (188), Expect = 9e-15 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = +3 Query: 3 AKSKNHTNHNQNRKAHRNGINKPRKTRHASTLGMDPKFLRNHRFCKNGNLKPAKQL 170 AKSKNHT HNQ+RK HRNGI KPR R+ S G+DPKFLRN RF K N K K++ Sbjct: 2 AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >AL450405-1|CAI16223.1| 172|Homo sapiens protein ( Human DNA sequence from clone RP11-632C17 on chromosome 6 Contains the gene for a novel protein similar to ribosomal protein L29 ). Length = 172 Score = 79.8 bits (188), Expect = 9e-15 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = +3 Query: 3 AKSKNHTNHNQNRKAHRNGINKPRKTRHASTLGMDPKFLRNHRFCKNGNLKPAKQL 170 AKSKNHT HNQ+RK HRNGI KPR R+ S G+DPKFLRN RF K N K K++ Sbjct: 17 AKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 72 >CR533465-1|CAG38496.1| 105|Homo sapiens RPL36 protein. Length = 105 Score = 70.5 bits (165), Expect = 5e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 510 VSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 620 VSKDKRALKF+K+R+GTHIRAKRKREELSNVLA MRK Sbjct: 63 VSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRK 99 Score = 69.7 bits (163), Expect = 9e-12 Identities = 38/75 (50%), Positives = 48/75 (64%) Frame = +1 Query: 295 MAPRFEIAVGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVREVVGH 474 MA R+ +AVGL KGHK TK + R +R +G TKH+KFVRD++REV G Sbjct: 1 MALRYPMAVGLNKGHKVTK----------NVSKPRHSRRRGRLTKHTKFVRDMIREVCGF 50 Query: 475 AQYEKRAMELLRCQK 519 A YE+RAMELL+ K Sbjct: 51 APYERRAMELLKVSK 65 >BC091508-1|AAH91508.1| 105|Homo sapiens ribosomal protein L36 protein. Length = 105 Score = 70.5 bits (165), Expect = 5e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 510 VSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 620 VSKDKRALKF+K+R+GTHIRAKRKREELSNVLA MRK Sbjct: 63 VSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRK 99 Score = 69.7 bits (163), Expect = 9e-12 Identities = 38/75 (50%), Positives = 48/75 (64%) Frame = +1 Query: 295 MAPRFEIAVGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVREVVGH 474 MA R+ +AVGL KGHK TK + R +R +G TKH+KFVRD++REV G Sbjct: 1 MALRYPMAVGLNKGHKVTK----------NVSKPRHSRRRGRLTKHTKFVRDMIREVCGF 50 Query: 475 AQYEKRAMELLRCQK 519 A YE+RAMELL+ K Sbjct: 51 APYERRAMELLKVSK 65 >BC004971-1|AAH04971.1| 105|Homo sapiens ribosomal protein L36 protein. Length = 105 Score = 70.5 bits (165), Expect = 5e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 510 VSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 620 VSKDKRALKF+K+R+GTHIRAKRKREELSNVLA MRK Sbjct: 63 VSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRK 99 Score = 69.7 bits (163), Expect = 9e-12 Identities = 38/75 (50%), Positives = 48/75 (64%) Frame = +1 Query: 295 MAPRFEIAVGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVREVVGH 474 MA R+ +AVGL KGHK TK + R +R +G TKH+KFVRD++REV G Sbjct: 1 MALRYPMAVGLNKGHKVTK----------NVSKPRHSRRRGRLTKHTKFVRDMIREVCGF 50 Query: 475 AQYEKRAMELLRCQK 519 A YE+RAMELL+ K Sbjct: 51 APYERRAMELLKVSK 65 >BC003052-1|AAH03052.1| 105|Homo sapiens ribosomal protein L36 protein. Length = 105 Score = 70.5 bits (165), Expect = 5e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 510 VSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 620 VSKDKRALKF+K+R+GTHIRAKRKREELSNVLA MRK Sbjct: 63 VSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRK 99 Score = 69.7 bits (163), Expect = 9e-12 Identities = 38/75 (50%), Positives = 48/75 (64%) Frame = +1 Query: 295 MAPRFEIAVGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVREVVGH 474 MA R+ +AVGL KGHK TK + R +R +G TKH+KFVRD++REV G Sbjct: 1 MALRYPMAVGLNKGHKVTK----------NVSKPRHSRRRGRLTKHTKFVRDMIREVCGF 50 Query: 475 AQYEKRAMELLRCQK 519 A YE+RAMELL+ K Sbjct: 51 APYERRAMELLKVSK 65 >AB061833-1|BAB79471.1| 105|Homo sapiens ribosomal protein L36 protein. Length = 105 Score = 70.5 bits (165), Expect = 5e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 510 VSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 620 VSKDKRALKF+K+R+GTHIRAKRKREELSNVLA MRK Sbjct: 63 VSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRK 99 Score = 69.7 bits (163), Expect = 9e-12 Identities = 38/75 (50%), Positives = 48/75 (64%) Frame = +1 Query: 295 MAPRFEIAVGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVREVVGH 474 MA R+ +AVGL KGHK TK + R +R +G TKH+KFVRD++REV G Sbjct: 1 MALRYPMAVGLNKGHKVTK----------NVSKPRHSRRRGRLTKHTKFVRDMIREVCGF 50 Query: 475 AQYEKRAMELLRCQK 519 A YE+RAMELL+ K Sbjct: 51 APYERRAMELLKVSK 65 >AB046410-1|BAB21256.1| 32|Homo sapiens ribosomal protein L36 protein. Length = 32 Score = 60.1 bits (139), Expect = 7e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 510 VSKDKRALKFLKRRLGTHIRAKRKREELSN 599 VSKDKRALKF+K+R+GTHIRAKRKREELSN Sbjct: 3 VSKDKRALKFIKKRVGTHIRAKRKREELSN 32 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,591,599 Number of Sequences: 237096 Number of extensions: 1568158 Number of successful extensions: 3439 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 3274 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3433 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8007229802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -