BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00629X (567 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schi... 26 4.4 SPBC1685.07c |||amino acid transporter |Schizosaccharomyces pomb... 25 5.9 SPAC343.19 ||SPAC824.01|phosphatidylinositol 4-kinase Lsb6 |Schi... 25 7.7 >SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3071 Score = 25.8 bits (54), Expect = 4.4 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 263 LIIPWKSWKRSARTTFTLISCEEIYLLIHP 352 L IPW + + + T I+ E+IYL IHP Sbjct: 66 LEIPWSNLRNKSLT----INIEDIYLSIHP 91 >SPBC1685.07c |||amino acid transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 420 Score = 25.4 bits (53), Expect = 5.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 126 IFLFSNPLSCHQCYTGHYE 70 + LFS PL CH C Y+ Sbjct: 292 LVLFSYPLQCHPCRNSVYQ 310 >SPAC343.19 ||SPAC824.01|phosphatidylinositol 4-kinase Lsb6 |Schizosaccharomyces pombe|chr 1|||Manual Length = 624 Score = 25.0 bits (52), Expect = 7.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 301 YYIYLNILRRNLSTNSSCNIYRPCI 375 YY +N+L NL+ N S N P I Sbjct: 369 YYKSINLLSTNLTPNMSANSVDPAI 393 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,092,099 Number of Sequences: 5004 Number of extensions: 37970 Number of successful extensions: 100 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 240047038 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -