BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00629X (567 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 25 1.3 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 24 4.0 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 23 5.3 Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS... 23 6.9 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 23 6.9 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 25.4 bits (53), Expect = 1.3 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +1 Query: 307 IYLNILRRNLSTNSSCNIYRPCILLVAVRRKILQIKFIVN 426 +YL R T S C R C ++V+ RK L VN Sbjct: 22 VYLREKLRLCGTKSMCREMRACTVMVSSDRKRLTASSAVN 61 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 23.8 bits (49), Expect = 4.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 81 PYNIGGSSRDLKKEKSPERLPK 146 P + GG S+ KK+K LPK Sbjct: 148 PKSSGGQSKQPKKKKKKRSLPK 169 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 23.4 bits (48), Expect = 5.3 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 227 SLISLIYLVIFTFSRYFV 174 S +S+ Y+V FTF R+ V Sbjct: 122 SFLSVWYVVAFTFERFIV 139 >Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS11 protein. Length = 151 Score = 23.0 bits (47), Expect = 6.9 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +1 Query: 283 LEKICAYYIYLNILRRNLSTNSSCNIYRPCILLVAVRRKILQ 408 ++K C + +++I R L+ + R CI+L+ +RR LQ Sbjct: 51 IDKKCPFTGHISIRGRILT-----GVVRKCIVLLYIRRDYLQ 87 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +1 Query: 457 TCLIAAECSCSSRRYPPLHTADSVSLRDIV 546 TC EC + +PP+ S + DI+ Sbjct: 313 TCECCIECKMARSPFPPVAGKTSTEVLDII 342 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 524,545 Number of Sequences: 2352 Number of extensions: 9451 Number of successful extensions: 31 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53404389 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -