BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00625 (571 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 23 2.4 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 7.4 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 21 7.4 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 22.6 bits (46), Expect = 2.4 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 153 KFNFITISIFILC 191 K F+ +S+FILC Sbjct: 251 KITFVIVSVFILC 263 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/32 (25%), Positives = 16/32 (50%) Frame = -1 Query: 397 LYLNSDTFMRYNINMRKIRLKQINANIFLNVE 302 LYLN++ + YN+ + ++ N V+ Sbjct: 426 LYLNNEGSLVYNVQIENLKTTPDNTTFITLVD 457 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 21.0 bits (42), Expect = 7.4 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -3 Query: 230 DQSNQWVLQLKLST*NENTDGDEVEFLC 147 D + W+L KL N G V FLC Sbjct: 265 DYRSLWMLLSKLIRDVGNASGYTVTFLC 292 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,633 Number of Sequences: 336 Number of extensions: 2476 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14099535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -