BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00624X (509 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 5.6 EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 21 7.4 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 7.4 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 7.4 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 21 7.4 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 5.6 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -1 Query: 314 AYNTYMRSA*NGWTSSNFGNPE*FWTVGRGSS 219 AYNTY R+A + P+ + RG+S Sbjct: 418 AYNTYGRNAGLRYRGPKQNKPKVLHAIRRGAS 449 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 21.0 bits (42), Expect = 7.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 217 AELPRPTVQNYSGFPKLDDVHP 282 A+L P +++Y G K D HP Sbjct: 62 ADLFDPIIEDYHGGFKKTDKHP 83 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 59 LYNFKKIAVVPTATD 103 LYN K+ A + ATD Sbjct: 171 LYNCKRTATITAATD 185 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.0 bits (42), Expect = 7.4 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 447 GSGSHGHHPE 476 G G +GHHP+ Sbjct: 277 GLGHYGHHPD 286 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.0 bits (42), Expect = 7.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 217 AELPRPTVQNYSGFPKLDDVHP 282 A+L P +++Y G K D HP Sbjct: 78 ADLFDPIIEDYHGGFKKTDKHP 99 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,306 Number of Sequences: 438 Number of extensions: 3009 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14109465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -