BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00623X (595 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33863| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_58791| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_21238| Best HMM Match : 7tm_3 (HMM E-Value=6.5e-10) 29 2.8 SB_48927| Best HMM Match : DUF922 (HMM E-Value=0.62) 27 8.6 >SB_33863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 597 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +3 Query: 144 THLENQHCQHIQLVFLLKTNTQDT 215 THL +QH H Q +FL K + +DT Sbjct: 85 THLLSQHLLHPQFIFLAKPDAEDT 108 >SB_58791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 679 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 Query: 89 LRYYLNDKGDREYTLATIDPFGKPTLSAHPARFSPEDKYSRHRIII 226 L+YY +R +TLA + P+ T A P +P+ SR II Sbjct: 599 LKYYSGGARERRHTLAVLPPYHPST--ADPGSGAPQTNRSRFNSII 642 >SB_21238| Best HMM Match : 7tm_3 (HMM E-Value=6.5e-10) Length = 270 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 Query: 89 LRYYLNDKGDREYTLATIDPFGKPTLSAHPARFSPEDKYSRHRIII 226 L+YY +R +TLA + P+ T A P +P+ SR II Sbjct: 190 LKYYSGGARERRHTLAVLPPYHPST--ADPGSGAPQTNRSRFNSII 233 >SB_48927| Best HMM Match : DUF922 (HMM E-Value=0.62) Length = 262 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -2 Query: 390 VFCCMLYKSCVP*ILKIIVKMYQNLDHFGNFQCK 289 V C+L SCV +L+ LDHFG+F K Sbjct: 4 VLVCLLLASCVA-LLRAAPTAPNFLDHFGSFHTK 36 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,066,900 Number of Sequences: 59808 Number of extensions: 334427 Number of successful extensions: 554 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -