Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS00619X
         (336 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ071552-1|AAY82248.1|  495|Apis mellifera anarchy 1 protein.          22   1.7  
DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase ...    20   9.2  
DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase ...    20   9.2  

>DQ071552-1|AAY82248.1|  495|Apis mellifera anarchy 1 protein.
          Length = 495

 Score = 22.2 bits (45), Expect = 1.7
 Identities = 10/34 (29%), Positives = 20/34 (58%)
 Frame = -2

Query: 239 LRSRTLMPSKALANRPGPSGSTSTAAAFKMVEIF 138
           L + +L+P+   +    PS +TST  + K +++F
Sbjct: 373 LGNYSLVPTTTASPTTEPSTTTSTTISQKHIKVF 406


>DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase
           isoform B protein.
          Length = 931

 Score = 19.8 bits (39), Expect = 9.2
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +2

Query: 179 SQRGQVCSPKPWK 217
           +QRG V SP P K
Sbjct: 896 NQRGTVVSPPPTK 908


>DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase
           isoform A protein.
          Length = 969

 Score = 19.8 bits (39), Expect = 9.2
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +2

Query: 179 SQRGQVCSPKPWK 217
           +QRG V SP P K
Sbjct: 934 NQRGTVVSPPPTK 946


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 73,948
Number of Sequences: 438
Number of extensions: 1198
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 50
effective length of database: 124,443
effective search space used:  7591023
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)