BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00609 (566 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 122 2e-28 SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 85 5e-17 SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_34970| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_52986| Best HMM Match : zf-C2H2 (HMM E-Value=0.0042) 28 4.6 SB_48401| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) 28 4.6 SB_37206| Best HMM Match : MFS_1 (HMM E-Value=3.4e-17) 28 6.1 SB_3221| Best HMM Match : rve (HMM E-Value=3) 27 8.1 >SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 413 Score = 122 bits (294), Expect = 2e-28 Identities = 55/66 (83%), Positives = 61/66 (92%) Frame = +3 Query: 66 NHRREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQL 245 +HRR+Q+W DK +KKAH+GT KANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQL Sbjct: 14 SHRRDQKWHDKAYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQL 73 Query: 246 IKNERK 263 IKN +K Sbjct: 74 IKNGKK 79 Score = 45.6 bits (103), Expect = 3e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +2 Query: 257 KKVTAFVPRDGCLNHIEENDE 319 KK+TAFVP DGCLN+IEENDE Sbjct: 78 KKITAFVPNDGCLNYIEENDE 98 Score = 37.5 bits (83), Expect = 0.008 Identities = 13/17 (76%), Positives = 17/17 (100%) Frame = +1 Query: 325 VAGFGRKGHAVGDIPGV 375 ++GFGR+GHAVGDIPG+ Sbjct: 101 ISGFGRRGHAVGDIPGI 117 >SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 143 Score = 84.6 bits (200), Expect = 5e-17 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = +1 Query: 325 VAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 450 ++GFGR+GHAVGDIPGVRFKVVKVANVSLLAL+KEKKERPRS Sbjct: 102 ISGFGRRGHAVGDIPGVRFKVVKVANVSLLALFKEKKERPRS 143 Score = 50.8 bits (116), Expect = 8e-07 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +3 Query: 180 EKVGVEAKQPNSAIRKCVRVQLIKNERK 263 ++ GVEAKQPNSAIRKCVRVQLIKN +K Sbjct: 53 QEPGVEAKQPNSAIRKCVRVQLIKNGKK 80 Score = 45.6 bits (103), Expect = 3e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +2 Query: 257 KKVTAFVPRDGCLNHIEENDE 319 KK+TAFVP DGCLN+IEENDE Sbjct: 79 KKITAFVPNDGCLNYIEENDE 99 >SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 29.1 bits (62), Expect = 2.6 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +2 Query: 110 SPHGYEMEG*PFRWCISRKGHRPRESWCRS*AA 208 S HG MEG P W +S G P+ S C S +A Sbjct: 85 SQHGTRMEGVPVCWYVSVWGLSPQVSQCDSVSA 117 >SB_34970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 866 Score = 28.7 bits (61), Expect = 3.5 Identities = 20/56 (35%), Positives = 28/56 (50%) Frame = -1 Query: 341 RPNPATSIRRFLRCGLGNRHGGRMRSLSFVLNELYTDAFADGRVGLLSFYTNFLED 174 +P+ T IR FL+ L ++H +FV N+L GR+ FY NFL D Sbjct: 69 QPSDKTEIRSFLKQYLLSQHKALP---AFVRNKLAKVIVDMGRLDWPHFYPNFLSD 121 >SB_52986| Best HMM Match : zf-C2H2 (HMM E-Value=0.0042) Length = 623 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +2 Query: 416 LSTKRKRSDQDHRCTL**VTCCREARCL*VHKCKILVHNKYCV 544 +S+KR RS+ + C V CC E V KC V K CV Sbjct: 1 MSSKRTRSESSNLC----VVCCEEIEFSAVGKCDHPVCYKCCV 39 >SB_48401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 694 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +2 Query: 416 LSTKRKRSDQDHRCTL**VTCCREARCL*VHKCKILVHNKYCV 544 +S+KR RS+ + C V CC E V KC V K CV Sbjct: 1 MSSKRTRSESSNLC----VVCCEEIEFSAVGKCDHPVCYKCCV 39 >SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) Length = 943 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = -2 Query: 178 RTMPFA*D-APPKGLAFHFVPMW-AFLN-SLSAHR 83 R +PF+ APPKG F VP+W +F N S+ HR Sbjct: 902 RKVPFSSVLAPPKGYRFLIVPLWRSFSNRSVFGHR 936 >SB_37206| Best HMM Match : MFS_1 (HMM E-Value=3.4e-17) Length = 1088 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 271 CGHFLSFLMSCTRTHLRMAELGCLASTPTFS 179 CG FL+F M+ + ELGC+ S P S Sbjct: 608 CGAFLTFGMAAAVIGPTLLELGCVTSRPVNS 638 >SB_3221| Best HMM Match : rve (HMM E-Value=3) Length = 324 Score = 27.5 bits (58), Expect = 8.1 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = -1 Query: 473 SLITMYTYDLGRSFFSL*RARRDTLATFTTLKRTPGMSPTA*PLRP 336 S T TYDL SF+S+ + + LAT +K++P + + L+P Sbjct: 9 SFDTFPTYDLA-SFYSVLCSGDEQLATIKLMKKSPSLFQKSHTLKP 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,893,658 Number of Sequences: 59808 Number of extensions: 416740 Number of successful extensions: 808 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 808 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -