BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00608 (678 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g10830.1 68414.m01244 sodium symporter-related contains five ... 30 1.6 At5g17990.1 68418.m02110 anthranilate phosphoribosyltransferase ... 27 8.6 At1g19680.1 68414.m02453 expressed protein 27 8.6 >At1g10830.1 68414.m01244 sodium symporter-related contains five transmembrane domains; Interpro IPR001991 Sodium:dicarboxylate symporter; EST gb|F13926 comes from this gene Length = 367 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 641 KLYKWLLIDVASAKTIFVLNAVWVFKSAG 555 KL W+ V +F+LN VW+ S G Sbjct: 92 KLVSWVYFGVVLGVVLFILNVVWIDNSTG 120 >At5g17990.1 68418.m02110 anthranilate phosphoribosyltransferase identical to anthranilate phosphoribosyltransferase, chloroplast precursor (EC 2.4.2.18) SP:Q02166 from [Arabidopsis thaliana] Length = 444 Score = 27.5 bits (58), Expect = 8.6 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +1 Query: 367 DSVKTVTISTGP--ITKRCAADVARIVNASESSSL-PTDILKIL 489 D TV ISTG + C A VA+ N S SS+ D+L+ L Sbjct: 188 DGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGSADVLEAL 231 >At1g19680.1 68414.m02453 expressed protein Length = 444 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 115 LPNTLLRYVPPREDPDRQRAGTPCRLLGRGKSD 213 LP+ +PPR P R+ G+P + L R SD Sbjct: 148 LPSAHTHSLPPRSTPSRRARGSPGQQLFRQVSD 180 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,236,549 Number of Sequences: 28952 Number of extensions: 296495 Number of successful extensions: 828 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 828 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1428369392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -