BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00607X (390 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 24 1.7 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 24 1.7 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 23 3.9 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 22 6.9 AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal ... 22 9.1 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 24.2 bits (50), Expect = 1.7 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 244 RTPLCVRQLITALRSACCTXVCRAHRC-YAYCGA 342 RT C+ + + CT V +A +C Y Y GA Sbjct: 119 RTEACLAENLYTCDDDLCTQVYKAFQCYYQYYGA 152 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 24.2 bits (50), Expect = 1.7 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 244 RTPLCVRQLITALRSACCTXVCRAHRC-YAYCGA 342 RT C+ + + CT V +A +C Y Y GA Sbjct: 119 RTEACLAENLYTCDDDLCTQVYKAFQCYYQYYGA 152 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 23.0 bits (47), Expect = 3.9 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 2/76 (2%) Frame = +3 Query: 15 VVTQISATMSGGLDVLALNEEDVTKMLAATTHLGADNVNFQMETYVYKRRADGTHVLNLR 194 +VT+++ + G+D+LA +EDV + L + T +++RR DGT +R Sbjct: 202 IVTEMAEVLITGIDMLA-KKEDVERGL----QRALERTAVAATTSLWERR-DGTQRARVR 255 Query: 195 --RTWEKLVLAARAVV 236 R L+L R VV Sbjct: 256 LPRRDTDLLLDKRIVV 271 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 22.2 bits (45), Expect = 6.9 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +2 Query: 83 HQNACCNHPSWGRQC 127 H NA C P +G C Sbjct: 398 HPNATCGRPEFGDYC 412 >AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal carrier protein AP-1 protein. Length = 171 Score = 21.8 bits (44), Expect = 9.1 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 148 MSTNDVLMVPMCSTCVVPG 204 +S V+MV +C+ C + G Sbjct: 2 LSKGHVMMVALCAVCAIFG 20 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 450,375 Number of Sequences: 2352 Number of extensions: 10781 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 30356973 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -