BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00607X (390 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 2.2 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 3.8 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.2 bits (45), Expect = 2.2 Identities = 13/49 (26%), Positives = 19/49 (38%) Frame = -2 Query: 251 GVLDGYDSTSSQNKFFPGTTQVEHMGTISTSFVDIGLHLEVNIVCPKMG 105 G + YD T K + S S V + LEVN + ++G Sbjct: 277 GHMISYDDTDGDGKLNVNEFYMAFSKLYSVSVVSLDKSLEVNHISARVG 325 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.4 bits (43), Expect = 3.8 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 30 SATMSGGLDVLALNEEDVTKML 95 S TMS L LALN +DV K L Sbjct: 310 STTMSNALYELALN-QDVQKKL 330 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,762 Number of Sequences: 438 Number of extensions: 2422 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9514659 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -