BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00606 (661 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30C2.06c |dml1||mitochondrial genome maintenance protein |Sc... 26 5.5 SPCC830.09c |||RNase P and RNase MRP subunit |Schizosaccharomyce... 25 9.7 SPAC13G7.05 |||acyl-coA-sterol acyltransferase |Schizosaccharomy... 25 9.7 >SPAC30C2.06c |dml1||mitochondrial genome maintenance protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 465 Score = 25.8 bits (54), Expect = 5.5 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = -1 Query: 397 NLMSVLFPEKKNFFNYSNYKDNKYISKEIVLDISTCVLFNGIVNHKSNDKCVY 239 ++ S L E + F + N+K Y SKE L +S+ N ++ + C++ Sbjct: 318 DIESKLQSEGRGFIHNLNFKAKNYSSKEWAL-VSSASFVNVAQDYSQQNNCLF 369 >SPCC830.09c |||RNase P and RNase MRP subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 139 Score = 25.0 bits (52), Expect = 9.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 394 LMSVLFPEKKNFFNYSNYKDNKYIS 320 L VL+PE K FF+Y + I+ Sbjct: 10 LFEVLYPEAKEFFDYPTIPSDSSIT 34 >SPAC13G7.05 |||acyl-coA-sterol acyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 25.0 bits (52), Expect = 9.7 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -1 Query: 388 SVLFPEKKNFFNYSNY 341 +V++P+ NFFNY +Y Sbjct: 298 NVVYPDNINFFNYVDY 313 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,225,262 Number of Sequences: 5004 Number of extensions: 38868 Number of successful extensions: 93 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -